CN184658
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN184658 vs. ExPASy Swiss-Prot
Match: CML27_ARATH (Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 4.676e-16 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = -3 Query: 146 GIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMTTS 253 G+ CSV+ C MI PVDADGDGNVNFEEF+ MMT+S Sbjct: 121 GMSCSVEDCTRMIGPVDADGDGNVNFEEFQKMMTSS 156 HSP 2 Score: 43.5134 bits (101), Expect = 4.676e-16 Identity = 19/23 (82.61%), Postives = 22/23 (95.65%), Query Frame = -2 Query: 276 AELREAFDLYDQDKNGLISAEEV 344 AE+R+AFDLYDQDKNGLISA E+ Sbjct: 91 AEIRDAFDLYDQDKNGLISASEL 113
BLAST of CN184658 vs. ExPASy Swiss-Prot
Match: CML26_ARATH (Probable calcium-binding protein CML26 OS=Arabidopsis thaliana GN=CML26 PE=1 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 3.276e-13 Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = -3 Query: 149 GIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMTT 253 G+ CSV+ CV MI VD DGDGNVNFEEF+ MM++ Sbjct: 118 GMTCSVEDCVRMIGHVDTDGDGNVNFEEFQKMMSS 152 HSP 2 Score: 40.817 bits (94), Expect = 3.276e-13 Identity = 17/22 (77.27%), Postives = 21/22 (95.45%), Query Frame = -2 Query: 276 ELREAFDLYDQDKNGLISAEEV 341 E+REAFDLYDQ+KNGLIS+ E+ Sbjct: 89 EIREAFDLYDQNKNGLISSSEI 110 The following BLAST results are available for this feature:
BLAST of CN184658 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN184658 ID=CN184658; Name=CN184658; organism=Citrus sinensis; type=EST; length=345bpback to top |