CN189117
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBM_HEVBR (ATP synthase subunit beta, mitochondrial OS=Hevea brasiliensis GN=ATPB PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.720e-13 Identity = 34/35 (97.14%), Postives = 34/35 (97.14%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYVELKESI SFQGVLDGKYDDLPEQSFYMVGG Sbjct: 511 PGKYVELKESITSFQGVLDGKYDDLPEQSFYMVGG 545
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBM_MAIZE (ATP synthase subunit beta, mitochondrial OS=Zea mays GN=ATPB PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.640e-13 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYVELKES+ SFQGVLDGKYDDLPEQSFYMVGG Sbjct: 502 PGKYVELKESVKSFQGVLDGKYDDLPEQSFYMVGG 536
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBM_ORYSJ (ATP synthase subunit beta, mitochondrial OS=Oryza sativa subsp. japonica GN=ATPB PE=1 SV=2) HSP 1 Score: 72.7886 bits (177), Expect = 6.060e-13 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYVELKES+ SFQGVLDGKYDDLPEQSFYMVGG Sbjct: 501 PGKYVELKESVNSFQGVLDGKYDDLPEQSFYMVGG 535
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBM_ACTDE (ATP synthase subunit beta, mitochondrial (Fragment) OS=Actinidia deliciosa GN=ATPB PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.763e-12 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYV+LKESI SFQGVLDGK+DDLPEQSFYMVGG Sbjct: 122 PGKYVDLKESITSFQGVLDGKFDDLPEQSFYMVGG 156
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBM_DAUCA (ATP synthase subunit beta, mitochondrial OS=Daucus carota GN=ATPB PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.008e-12 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYVELKE + SFQGVLDGKYDDLPEQSFYM+GG Sbjct: 496 PGKYVELKECVTSFQGVLDGKYDDLPEQSFYMLGG 530
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBM_NICPL (ATP synthase subunit beta, mitochondrial OS=Nicotiana plumbaginifolia GN=ATPB PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.751e-12 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYV+LKESI SFQGVLDGKYDDL EQSFYMVGG Sbjct: 509 PGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 543
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBO_ARATH (ATP synthase subunit beta-3, mitochondrial OS=Arabidopsis thaliana GN=At5g08680 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.343e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYV+LKE+I SFQG+LDGKYDDL EQSFYMVGG Sbjct: 508 PGKYVDLKENINSFQGLLDGKYDDLSEQSFYMVGG 542
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBN_ARATH (ATP synthase subunit beta-2, mitochondrial OS=Arabidopsis thaliana GN=At5g08690 PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.343e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYV+LKE+I SFQG+LDGKYDDL EQSFYMVGG Sbjct: 505 PGKYVDLKENINSFQGLLDGKYDDLSEQSFYMVGG 539
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPBM_ARATH (ATP synthase subunit beta-1, mitochondrial OS=Arabidopsis thaliana GN=At5g08670 PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.343e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYV+LKE+I SFQG+LDGKYDDL EQSFYMVGG Sbjct: 505 PGKYVDLKENINSFQGLLDGKYDDLSEQSFYMVGG 539
BLAST of CN189117 vs. ExPASy Swiss-Prot
Match: ATPB_ARCB4 (ATP synthase subunit beta OS=Arcobacter butzleri (strain RM4018) GN=atpD PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.675e-11 Identity = 27/35 (77.14%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 318 PGKYVELKESIASFQGVLDGKYDDLPEQSFYMVGG 422 PGKYVELK++IA FQG+LDGKYD++PE +FYMVGG Sbjct: 418 PGKYVELKDTIAGFQGILDGKYDNIPEMAFYMVGG 452 The following BLAST results are available for this feature:
BLAST of CN189117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 10
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN189117 ID=CN189117; Name=CN189117; organism=Citrus sinensis; type=EST; length=424bpback to top |