CN189116

Overview
NameCN189116
Unique NameCN189116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length548
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12367 contig Csv1_Contig12367:631..1178. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: ASPG2_ARATH (Probable isoaspartyl peptidase/L-asparaginase 2 OS=Arabidopsis thaliana GN=At3g16150 PE=2 SV=2)

HSP 1 Score: 227.254 bits (578), Expect = 3.875e-59
Identity = 114/143 (79.72%), Postives = 119/143 (83.22%), Query Frame = -2
Query:  119 QMNRLPISLYAPETVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNLCGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDEGQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGIW 547
            QMN LPIS+YAPETVGCVVV  +G CAA TSTGGLMNK  GRIGDSPLIG GTYAS  CGVSCT EG AIIRATLARDV+AVMEY GL LQEAVD+VIK  LDEG A  IAVS  GEV CGFN+NGMFRGCATEDGF EV IW
Sbjct:  182 QMNGLPISIYAPETVGCVVVDGKGHCAAGTSTGGLMNKMMGRIGDSPLIGAGTYASEFCGVSCTGEGEAIIRATLARDVSAVMEYKGLNLQEAVDYVIKHRLDEGFAGLIAVSNKGEVVCGFNSNGMFRGCATEDGFMEVAIW 324          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: ASPG_LUPLU (Isoaspartyl peptidase/L-asparaginase OS=Lupinus luteus PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.635e-41
Identity = 83/131 (63.36%), Postives = 97/131 (74.05%), Query Frame = -2
Query:  116 TVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNLCGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDEGQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGIWP 508
            TVGCV V   G  A+ATSTGGL+NK  GRIGD+PLIG GTYA+ LC VS T +G  IIRAT+ARDVAA+ME+ GL L+EA DFVI E   +G    IAVS  GE++  FN  GMFR CATEDG+SE+ IWP
Sbjct:  193 TVGCVAVDSHGNLASATSTGGLVNKMVGRIGDTPLIGAGTYANELCAVSATGKGEEIIRATVARDVAALMEFKGLSLKEAADFVIHERTPKGTVGLIAVSAAGEIAMPFNTTGMFRACATEDGYSEIAIWP 323          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: ASPG_LUPAL (Isoaspartyl peptidase/L-asparaginase OS=Lupinus albus PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 4.759e-41
Identity = 82/131 (62.60%), Postives = 97/131 (74.05%), Query Frame = -2
Query:  116 TVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNLCGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDEGQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGIWP 508
            TVGCV V   G  A+ATSTGGL+NK  GRIGD+PLIG GTYA+ LC VS T +G AIIRAT+ARDVAA+ME+ GL L+EA D V+ E   +G    IAVS  GE++  FN  GMFR CATEDG+SE+ IWP
Sbjct:  193 TVGCVAVDSHGNLASATSTGGLVNKMVGRIGDTPLIGAGTYANELCAVSATGKGEAIIRATVARDVAALMEFKGLSLKEAADCVVHERTPKGTVGLIAVSAAGEIAMPFNTTGMFRACATEDGYSEIAIWP 323          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: ASPG_LUPAR (Isoaspartyl peptidase/L-asparaginase (Fragment) OS=Lupinus arboreus PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.060e-40
Identity = 81/131 (61.83%), Postives = 98/131 (74.81%), Query Frame = -2
Query:  116 TVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNLCGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDEGQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGIWP 508
            TVGCV V  +G  A+ATSTGGL+NK  GRIGD+PLIG GTYA+ LC VS T +G AII+AT+ARDVAA+ME+ GL L+EA D+V+ E   +G    IAVS  GE++  FN  GMFR CATEDG SE+ IWP
Sbjct:  174 TVGCVAVDSQGNLASATSTGGLVNKMVGRIGDTPLIGAGTYANELCAVSATGKGEAIIQATVARDVAALMEFKGLSLKEAADYVVHERTPKGTVGLIAVSAAGEIAMPFNTTGMFRACATEDGNSEIAIWP 304          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: ASPG_LUPAN (Isoaspartyl peptidase/L-asparaginase OS=Lupinus angustifolius PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 8.974e-40
Identity = 80/131 (61.07%), Postives = 96/131 (73.28%), Query Frame = -2
Query:  116 TVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNLCGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDEGQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGIWP 508
            TVGCV V   G  A+ATSTGGL+NK  GRIGD+PLIG GTYA+ LC VS T +G AII AT+ARDVAA+ME+ GL L+EA D+V+ E   +G    IAVS  GE++  FN  GMFR  ATEDG+SE+ IWP
Sbjct:  193 TVGCVAVDSHGNLASATSTGGLVNKMVGRIGDTPLIGAGTYANELCAVSATGKGEAIISATVARDVAALMEFKGLSLKEAADYVVHERTPKGTVGLIAVSAAGEIAMPFNTTGMFRASATEDGYSEIAIWP 323          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: ASPG1_ARATH (Isoaspartyl peptidase/L-asparaginase 1 OS=Arabidopsis thaliana GN=At5g08100 PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.172e-39
Identity = 77/131 (58.78%), Postives = 96/131 (73.28%), Query Frame = -2
Query:  116 TVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNLCGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDEGQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGIWP 508
            TVGCV V   G  A+ATSTGG +NK  GRIGD+P+IG GTYA++LC +S T +G  IIR T+ARDVAA+MEY GL L EA  +V+ +S+  G    +AVS NGEV+  FN  GMFR CA+EDG+SE+ IWP
Sbjct:  183 TVGCVAVDSAGNLASATSTGGYVNKMVGRIGDTPVIGAGTYANHLCAISATGKGEDIIRGTVARDVAALMEYKGLSLTEAAAYVVDQSVPRGSCGLVAVSANGEVTMPFNTTGMFRACASEDGYSEIAIWP 313          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: IAAA_ECOLI (Isoaspartyl peptidase OS=Escherichia coli (strain K12) GN=iaaA PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 4.475e-23
Identity = 61/133 (45.86%), Postives = 76/133 (57.14%), Query Frame = -2
Query:  119 TVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNL-CGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDE--GQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGIW 508
            TVG V +  +G  AAATSTGG+ NK  GR+GDSPL+G G YA+N    VSCT  G   IRA  A D+AA+M+Y GL L EA + V+ E L    G    IA+   G V+  FN  GM+R           GI+
Sbjct:  179 TVGAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRALAAYDIAALMDYGGLSLAEACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEGMYRAWGYAGDTPTTGIY 311          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: IAAA_SALTY (Isoaspartyl peptidase OS=Salmonella typhimurium GN=iaaA PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.788e-22
Identity = 61/133 (45.86%), Postives = 75/133 (56.39%), Query Frame = -2
Query:  119 TVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNL-CGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDE--GQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGIW 508
            TVG V   + G  AAATSTGG+ NK  GR+GDSPL+G G YA+N    VSCT  G   IR   A D+AA+MEY GL L +A + V+ E L    G    IAV   G V+  FN+ GM+R           GI+
Sbjct:  179 TVGAVARDKFGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRTLAAYDIAALMEYGGLSLADACERVVMEKLPALGGSGGLIAVDHEGNVALPFNSEGMYRAWGYAGDTPTTGIY 311          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: ASGX_DICDI (Putative isoaspartyl peptidase/L-asparaginase OS=Dictyostelium discoideum GN=DDB_G0279357 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.455e-21
Identity = 59/131 (45.04%), Postives = 73/131 (55.73%), Query Frame = -2
Query:  131 YAPETVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNLCGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESL-DEGQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSE 520
            Y   TVG V +   G  AAATSTGG+ NK  GR+GD+P+IG G YA+    VS T  G A +R   A D+AA+MEY  L L++A + V+ E L   G    I V K G V   FN  GM+RG    D   E
Sbjct:  203 YKMGTVGAVCLDSFGNLAAATSTGGMTNKMHGRVGDTPIIGAGVYANKNVAVSSTGTGEAFMRTVAAFDIAAMMEYGSLSLKDASNKVVMEKLITVGDGGVICVDKYGNVEMPFNTEGMYRGYVIIDNNCE 333          
BLAST of CN189116 vs. ExPASy Swiss-Prot
Match: ASGL1_DROME (Probable L-asparaginase CG7860 OS=Drosophila melanogaster GN=CG7860 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.434e-15
Identity = 52/133 (39.10%), Postives = 69/133 (51.88%), Query Frame = -2
Query:  122 ETVGCVVVAQEGRCAAATSTGGLMNKRTGRIGDSPLIGVGTYASNL-CGVSCTREGVAIIRATLARDVAAVMEYTGLCLQEAVDFVIKESLDE--GQAVFIAVSKNGEVSCGFNANGMFRGCATEDGFSEVGI 511
            ETVG V +   G+    TSTGG+  K  GRIGD+P++G GTYA N   GVS T  G  ++R  LA+ + + MEY GL  Q A D   +E      G    I V  +G++   F +  M  G   +DG    GI
Sbjct:  187 ETVGAVAMDASGQIVVGTSTGGITGKWPGRIGDTPILGSGTYADNCRGGVSTTGHGETLMRYNLAQRILSAMEYQGLSAQAAADKECREMTKRLGGTGGAIVVGHSGDLGISFTSRRMAWG-YVQDGTIFYGI 318          
The following BLAST results are available for this feature:
BLAST of CN189116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
ASPG2_ARATH3.875e-5979.72Probable isoaspartyl peptidase/L-asparaginase 2 OS... [more]
ASPG_LUPLU1.635e-4163.36Isoaspartyl peptidase/L-asparaginase OS=Lupinus lu... [more]
ASPG_LUPAL4.759e-4162.60Isoaspartyl peptidase/L-asparaginase OS=Lupinus al... [more]
ASPG_LUPAR1.060e-4061.83Isoaspartyl peptidase/L-asparaginase (Fragment) OS... [more]
ASPG_LUPAN8.974e-4061.07Isoaspartyl peptidase/L-asparaginase OS=Lupinus an... [more]
ASPG1_ARATH1.172e-3958.78Isoaspartyl peptidase/L-asparaginase 1 OS=Arabidop... [more]
IAAA_ECOLI4.475e-2345.86Isoaspartyl peptidase OS=Escherichia coli (strain ... [more]
IAAA_SALTY3.788e-2245.86Isoaspartyl peptidase OS=Salmonella typhimurium GN... [more]
ASGX_DICDI2.455e-2145.04Putative isoaspartyl peptidase/L-asparaginase OS=D... [more]
ASGL1_DROME3.434e-1539.10Probable L-asparaginase CG7860 OS=Drosophila melan... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001F12_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001F12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189116 ID=CN189116|Name=CN189116|organism=Citrus sinensis|type=EST|length=548bp
CCAAATCTACGAGACGCTAGACATAGCAACACTACACGAGGTGCGGCAAT
CAACAGCACCAACATGAGTCATGACCAAAGCATTAAGAGAGGTAACTAAC
AGTTAAAAAGATTTAAGGCCAAATGCCAACTTCCGAGAACCCGTCCTCGG
TAGCACAACCCCTGAACATTCCATTAGCGTTGAAGCCACAAGACACTTCC
CCATTCTTCGACACCGCGATGAATACAGCTTGCCCTTCATCGAGGCTCTC
TTTAATCACAAAATCAACAGCCTCTTGCAGGCACAAGCCTGTGTACTCCA
TCACAGCCGCCACATCACGCGCCAAGGTCGCACGTATGATGGCCACCCCT
TCTCGCGTGCATGAGACCCCACAAAGATTAGAGGCGTAGGTCCCAACACC
AATAAGAGGCGAGTCACCGATTCTGCCGGTCCTCTTATTCATCAGCCCTC
CCGTTGACGTGGCTGCAGCGCACCGACCCTCCTGGGCAACCACAACGCAC
CCAACCGTTTCTGGGGCGTACAGGCTTATTGGAAGTCGGTTCATTTGC
back to top