CN188932

Overview
NameCN188932
Unique NameCN188932
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length717
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7674 contig Csv1_Contig7674:412..1128. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: Y194_SYNY3 (Uncharacterized protein sll0194 OS=Synechocystis sp. (strain PCC 6803) GN=sll0194 PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.264e-50
Identity = 99/163 (60.74%), Postives = 121/163 (74.23%), Query Frame = -3
Query:  227 YCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLYFGGAWMVKLTGR 715
            Y G+L+ SP ILY+II FVLPGLTR ERR LGP+VLGSSVLF+AG+ F+Y+ L PAAL FFV+Y   VVE LWSID+YFEFVL+LMFSTGL+FQ+P+I         V+S+QML  WR+          +LTPSTDP+TQ LLA  +LGLYFGG   V+L G+
Sbjct:   92 YSGILVMSPFILYQIIQFVLPGLTRRERRLLGPVVLGSSVLFFAGLGFAYYALIPAALKFFVSYGADVVEQLWSIDKYFEFVLLLMFSTGLAFQIPIIQVVLGFLGIVSSEQMLKGWRFVILGAMVLGAILTPSTDPLTQSLLAGAVLGLYFGGIGCVRLLGK 254          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: YCF43_GUITH (Uncharacterized tatC-like protein ycf43 OS=Guillardia theta GN=ycf43 PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.053e-40
Identity = 80/158 (50.63%), Postives = 109/158 (68.99%), Query Frame = -3
Query:  242 YCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLYFGGAWMV 715
            Y G+L+ SP I+Y+I+ FVLPG+T+ ER+ L PI++GS +LF  G+ F Y++L PA+LNFF+ Y   VVE  WS +QYFEF+LVL+F T L+FQ+PV+         V+   M SIWRY          VLTPS DP+TQ+LL++ +L LYFGGA +V
Sbjct:  122 YSGILISSPFIVYQILLFVLPGMTKDERKTLLPIIIGSMILFLLGLIFGYYILVPASLNFFIKYGSDVVEPFWSFEQYFEFILVLLFGTALAFQLPVLQLVLGFLRIVSGKTMFSIWRYVILLSTVVGAVLTPSVDPLTQILLSSIILILYFGGASLV 279          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: YCF43_ODOSI (Uncharacterized tatC-like protein ycf43 OS=Odontella sinensis GN=ycf43 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.985e-39
Identity = 79/160 (49.38%), Postives = 109/160 (68.12%), Query Frame = -3
Query:  236 YCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLYFGGAWMVKL 715
            Y G L GSP  + +II F+LPGLT+ E + + P++L S  LF  G+ FSY+ L PAALNFF+NY++ V+E LWS DQYFEF+LVL +STGL+FQ+P+I         +++ QML+ WRY          +LTPSTDP+TQ+LL+  +L LYF G  ++ L
Sbjct:  101 YTGFLFGSPFAIGQIILFLLPGLTKKETKIILPLLLSSLGLFGFGLVFSYYALIPAALNFFLNYSDEVIEPLWSFDQYFEFILVLFYSTGLAFQIPIIQILLGLLNIISAKQMLAAWRYIILVSTIIGAILTPSTDPLTQLLLSIAILMLYFSGVGILFL 260          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: YCF43_PORPU (Uncharacterized tatC-like protein ycf43 OS=Porphyra purpurea GN=ycf43 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.852e-39
Identity = 74/154 (48.05%), Postives = 108/154 (70.13%), Query Frame = -3
Query:  254 YCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLYFGG 715
            YCG++  +P  +Y++I ++LPGLT  ER+ + PI++GS VLF  G  F+Y+VL PAALNF ++Y   +VE LWS +QYF+F+L+L+FSTGL+F++P+I         V++ QML  WRY          VLTPSTDPVTQ+++++ +L LYF G
Sbjct:   92 YCGIVATTPFGVYQVILYILPGLTNKERKVILPILIGSIVLFIVGGIFAYFVLAPAALNFLISYGADIVEPLWSFEQYFDFILLLLFSTGLAFEIPIIQLLLGISGTVSASQMLLAWRYIIIISTIIGAVLTPSTDPVTQIIMSSAVLALYFSG 245          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: YCF43_GRATL (Uncharacterized tatC-like protein ycf43 OS=Gracilaria tenuistipitata var. liui GN=ycf43 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 8.341e-38
Identity = 69/163 (42.33%), Postives = 107/163 (65.64%), Query Frame = -3
Query:  227 YCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLYFGGAWMVKLTGR 715
            Y G LL SP I+Y+I  F+LPGLT+ E  F+ PI+  S +LF++GI F+Y +L PAAL F +NY   +VE +WS +QYF F+L+L+FSTG++FQ+P+I          +S +M + W+Y          ++TPSTDP+TQ++++  +L LY  G  ++K+  +
Sbjct:   76 YSGFLLSSPFIIYQITLFILPGLTKKESNFIVPILFISIILFFSGIVFAYIILVPAALKFLINYGNEIVEPIWSFEQYFNFILLLLFSTGIAFQIPIIQVILGILKIFSSSEMYAYWKYIVLGATVIAAIITPSTDPITQIIMSIAILALYSSGIIILKILNK 238          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: YCF43_PORYE (Uncharacterized tatC-like protein ycf43 OS=Porphyra yezoensis GN=ycf43 PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.406e-37
Identity = 68/154 (44.16%), Postives = 105/154 (68.18%), Query Frame = -3
Query:  254 YCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLYFGG 715
            YCG++  +P  +Y++I ++LPGLT  ER+ + P+++ S +LF  G  F+Y+VL PAAL F ++Y   +VE LWS +QYF+F+L+L+ STGL+F++P+I          +S QM+  WRY          +LTPSTDPVTQ+++++ +L LYFGG
Sbjct:   92 YCGIVATTPFAVYQVILYILPGLTGKERKIILPLLISSVLLFITGGIFAYFVLAPAALTFLISYGSDIVEPLWSFEQYFDFILLLLLSTGLAFEIPIIQLLLGVSGTFSSSQMIRAWRYIIIIATIAGAILTPSTDPVTQLIMSSAVLLLYFGG 245          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: YCF43_CYACA (Uncharacterized tatC-like protein ycf43 OS=Cyanidium caldarium GN=ycf43 PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.406e-37
Identity = 68/160 (42.50%), Postives = 104/160 (65.00%), Query Frame = -3
Query:  236 YCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLYFGGAWMVKL 715
            Y G++L SP+I YEII F++PGLT+ ERR L PI++ S  LF AG+ F Y  +TP A+ FF+NY + ++E +WS  +YF+F+++ +FST +SFQ+P+          + S  MLS+WRY          ++TPSTDP+ Q+ L+  ++ LYF    ++KL
Sbjct:   77 YLGIILSSPIIFYEIIIFIIPGLTKKERRLLIPILIASGCLFVAGLIFGYIYITPIAVRFFINYGKDMIEPIWSFKEYFDFIILSLFSTAISFQIPIFQILLGSLKIINSKMMLSVWRYVVVGSTIFSAIITPSTDPLIQLFLSVAVMFLYFSSILVLKL 236          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: TATC_ECOLI (Sec-independent protein translocase protein tatC OS=Escherichia coli (strain K12) GN=tatC PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 3.295e-18
Identity = 53/148 (35.81%), Postives = 80/148 (54.05%), Query Frame = -3
Query:  263 LLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLY 706
            L+L +PVILY++ AF+ P L + ERR + P+++ SS+LFY G+AF+Y+V+ P A  F  N A   V+    I  Y  FV+ L  + G+SF+VPV           + + +     Y          +LTP  D  +Q LLA P+  L+
Sbjct:   80 LILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRKKRPYVLVGAFVVGMLLTP-PDVFSQTLLAIPMYCLF 226          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: TATC_ECOL6 (Sec-independent protein translocase protein tatC OS=Escherichia coli O6 GN=tatC PE=3 SV=3)

HSP 1 Score: 92.0485 bits (227), Expect = 3.295e-18
Identity = 53/148 (35.81%), Postives = 80/148 (54.05%), Query Frame = -3
Query:  263 LLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLY 706
            L+L +PVILY++ AF+ P L + ERR + P+++ SS+LFY G+AF+Y+V+ P A  F  N A   V+    I  Y  FV+ L  + G+SF+VPV           + + +     Y          +LTP  D  +Q LLA P+  L+
Sbjct:   80 LILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRKKRPYVLVGAFVVGMLLTP-PDVFSQTLLAIPMYCLF 226          
BLAST of CN188932 vs. ExPASy Swiss-Prot
Match: TATC_ECO57 (Sec-independent protein translocase protein tatC OS=Escherichia coli O157:H7 GN=tatC PE=3 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 3.295e-18
Identity = 53/148 (35.81%), Postives = 80/148 (54.05%), Query Frame = -3
Query:  263 LLLGSPVILYEIIAFVLPGLTRAERRFLGPIVLGSSVLFYAGIAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIXXXXXXXXXVTSDQMLSIWRYXXXXXXXXXXVLTPSTDPVTQMLLAAPLLGLY 706
            L+L +PVILY++ AF+ P L + ERR + P+++ SS+LFY G+AF+Y+V+ P A  F  N A   V+    I  Y  FV+ L  + G+SF+VPV           + + +     Y          +LTP  D  +Q LLA P+  L+
Sbjct:   80 LILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRKKRPYVLVGAFVVGMLLTP-PDVFSQTLLAIPMYCLF 226          
The following BLAST results are available for this feature:
BLAST of CN188932 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
Y194_SYNY34.264e-5060.74Uncharacterized protein sll0194 OS=Synechocystis s... [more]
YCF43_GUITH1.053e-4050.63Uncharacterized tatC-like protein ycf43 OS=Guillar... [more]
YCF43_ODOSI1.985e-3949.38Uncharacterized tatC-like protein ycf43 OS=Odontel... [more]
YCF43_PORPU9.852e-3948.05Uncharacterized tatC-like protein ycf43 OS=Porphyr... [more]
YCF43_GRATL8.341e-3842.33Uncharacterized tatC-like protein ycf43 OS=Gracila... [more]
YCF43_PORYE5.406e-3744.16Uncharacterized tatC-like protein ycf43 OS=Porphyr... [more]
YCF43_CYACA5.406e-3742.50Uncharacterized tatC-like protein ycf43 OS=Cyanidi... [more]
TATC_ECOLI3.295e-1835.81Sec-independent protein translocase protein tatC O... [more]
TATC_ECOL63.295e-1835.81Sec-independent protein translocase protein tatC O... [more]
TATC_ECO573.295e-1835.81Sec-independent protein translocase protein tatC O... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001A24_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001A24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188932 ID=CN188932|Name=CN188932|organism=Citrus sinensis|type=EST|length=717bp
CTTTTTTTTATTCATCACATCACTGTCATTGCATCTATAGATAAAACACA
TACAATTATGGTACAAATCACATAGATAATTGATGTGGATGATACTCCTT
TCCTTTGTTAAGTTGTTACTTCTATGTTACATTTTCTGAGAATATACAAG
AGTCATGCGCGCCCTTCAAATGTGCGGGCCGCTGCAAACAAATTGGTTGA
ACTGAAAGCAGTGGAAAAATCACTTAACGTCCCGTAAGCTTAACCATCCA
TGCACCACCAAAATAAAGACCGAGAAGCGGTGCTGCTAGAAGCATCTGAG
TAACAGGATCAGTTGACGGTGTAAGTACAGCAGCCGCAATGACTGCCCCA
ACCACAACATATCGCCAGATCGATAACATTTGGTCACTTGTCACTAACCC
AACTTGTCCCAACAGAAGTTGTATAACTGGAACCTGGAAAGACAAGCCTG
TGCTGAACATGAGCACAAGTACAAACTCAAAGTATTGATCAATGGACCAC
AAAGACTCCACAACCCCTTCAGCATAATTAACAAAGAAATTTAAGGCCGC
TGGAGTTAGAACCCAGTAGGAGAAGGCAATTCCAGCATAGAAAAGTACTG
AAGAGCCTAAAACGATTGGCCCCAAGAACCTTCTCTCTGCTCTTGTAAGA
CCTGGGAGAACAAAGGCTATTATCTCATAGAGAATTACCGGGCTTCCCAG
AAGAAGACCACAATATC
back to top