CN188921

Overview
NameCN188921
Unique NameCN188921
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length447
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188921 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.015e-18
Identity = 53/84 (63.10%), Postives = 54/84 (64.29%), Query Frame = -1
Query:  190 APVAEGISLSISRGGYVAAAPLGAIFWTGFMGKNDLXXXXXXXXXXXXXXXXXPITGYYRPGNRAVGIDPAGFRGMLLNPKVRA 441
            APVA+GISLSISR GY AAAPLG I  TG M KNDL                 PITGYYRP NRAV IDPA  R MLLN KVRA
Sbjct:   13 APVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 96          
The following BLAST results are available for this feature:
BLAST of CN188921 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
LEA5_CITSI2.015e-1863.10Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001A18_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001A18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188921 ID=CN188921|Name=CN188921|organism=Citrus sinensis|type=EST|length=447bp
CTTTTTTTGACAAGTTACAAAACAAAATCCTGGAAATGCCCTATTAAAAG
TTGTCAAAAACCGTTGATATCAATACAACCGCAAAAACTTAAAAGGGGGT
CAAAATTGCCACTGGAACAACCTCCCTTAAAAAGTTAAAGCCCCCCTAAC
AGCAAAGGATCTGCTGCTATGCCCCCCCCCCCCCTAGTGGGCCCTGACTT
TGGGGTTCAACAGCATCCCCCGAAACCCTGCGGGATCAATCCCGACCGCC
CGATTCCCCGGCCTGTAATACCCCGTGATGGGATCTGGGGCCCCGGCAAA
AAAGGCCCCAAAATCCTCTCCCCCCGCAGGCCCCAAATCATTTTTCCCCA
TGAAACCCGTCCAAAATATGGCCCCCAAGGGGGCTGCTGCAACATATCCC
CCCCTGCTAATGGAAAGCGAAATGCCCTCCGCAACAGGAGCAAAAAA
back to top