CN188900

Overview
NameCN188900
Unique NameCN188900
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length654
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: C1TC_SPOFR (C-1-tetrahydrofolate synthase, cytoplasmic OS=Spodoptera frugiperda PE=2 SV=3)

HSP 1 Score: 187.193 bits (474), Expect = 6.488e-47
Identity = 91/153 (59.48%), Postives = 117/153 (76.47%), Query Frame = -1
Query:  154 FIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 612
            FIPCTP GC+EL+ R+GV I GKN VV+GRS IVG P S LL+  HATV++ H+ TKN  +IT  ADI++ A G   +VRGSW+KPGAVV+D G  P+    DP+ + G RL+GDV YEEA+++AS +TPVPGGVGPMTVAML+ NT+ +A+R
Sbjct:  142 FIPCTPAGCVELIKRTGVTIAGKNVVVLGRSRIVGTPVSELLKWEHATVTVCHSKTKNLSEITKTADILVVAIGRGEMVRGSWIKPGAVVIDCGINPIS---DPTKKSGQRLVGDVAYEEAVQVASHVTPVPGGVGPMTVAMLMRNTVQAARR 291          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: C1TC_DROME (C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster GN=pug PE=1 SV=4)

HSP 1 Score: 175.252 bits (443), Expect = 2.551e-43
Identity = 92/167 (55.09%), Postives = 122/167 (73.05%), Query Frame = -1
Query:  154 LNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 654
            +N G LA+ G    F+PCTP GC+EL+ RSGVEI G  AVV+GRS IVG P + LL+  +ATV++ H+ T+N E+IT  ADI++   GVA +V+GSW+KPGAVV+D   C ++V  D S   G +L+GDV Y EA+++A  +TPVPGGVGPMTVAML+ NT+ SA R
Sbjct:  164 VNEGRLAI-GDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELLKWANATVTVCHSKTRNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVID---CGINVKPDASKASGSKLVGDVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSAAR 326          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: C1TM_YEAST (C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae GN=MIS1 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 8.207e-42
Identity = 87/168 (51.79%), Postives = 120/168 (71.43%), Query Frame = -1
Query:  148 NIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKRAY 651
            N G LA +G +P FIPCTP GC++LL  + V++ GKNAVV+GRS+IVG P + LL+  +ATV++ H+ T+N  ++ S+ADIVIAA G+   V+  W+K GAVV+DVG   ++   D S + G +L+GDV ++      S ITPVPGGVGPMTVAML+SN L +AKR +
Sbjct:  160 NAGELAKKGGKPYFIPCTPYGCMKLLEEAHVKLDGKNAVVLGRSSIVGNPIASLLKNANATVTVCHSHTRNIAEVVSQADIVIAACGIPQYVKSDWIKEGAVVIDVG---INYVPDISKKSGQKLVGDVDFDSVKEKTSYITPVPGGVGPMTVAMLVSNVLLAAKRQF 324          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: C1TC_SCHPO (C-1-tetrahydrofolate synthase, cytoplasmic OS=Schizosaccharomyces pombe GN=SPBC839.16 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.640e-40
Identity = 84/166 (50.60%), Postives = 114/166 (68.67%), Query Frame = -1
Query:  154 NIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 651
            N+G L  R  +PLF  CTPKG + +L   G+ + GK+AVVIGRSNIVG P S+LL++ +ATV++ H+ T++   I   ADIV+AA G+ + V+  WLK G V +DVG   ++   D + + GYRL GD+ +E A  +AS ITPVPG VGPMTVAMLL N ++SA R
Sbjct:  127 NLGKLTKREGQPLFTACTPKGIMCILKHYGINVQGKHAVVIGRSNIVGRPMSILLEKANATVTLCHSKTESIADIVRTADIVVAAIGIPHFVKADWLKKGVVAIDVG---INSIPDATKKSGYRLTGDIDFENAKEVASAITPVPGSVGPMTVAMLLQNVVESAVR 289          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: C1TC_RAT (C-1-tetrahydrofolate synthase, cytoplasmic OS=Rattus norvegicus GN=Mthfd1 PE=1 SV=3)

HSP 1 Score: 162.925 bits (411), Expect = 1.310e-39
Identity = 81/167 (48.50%), Postives = 117/167 (70.06%), Query Frame = -1
Query:  154 LNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 654
            +N G LA    +  FIPCTPKGC+EL+  +GV+I G++AVV+GRS IVG P   LL  ++ATV+  H+ T + ++  ++ DI++ A G   +V+G W+KPGAVV+D   C ++   D +   G +++GDV Y+EA   AS ITPVPGGVGPMTVAML+ +T++SA+R
Sbjct:  130 INAGKLARGDLKDCFIPCTPKGCLELIKETGVQIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTADLDKEVNKGDILVVATGQPEMVKGEWIKPGAVVID---CGINYVPDDTKPNGRKVVGDVAYDEAKEKASFITPVPGGVGPMTVAMLMQSTVESAQR 293          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: C1TC_HUMAN (C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens GN=MTHFD1 PE=1 SV=3)

HSP 1 Score: 162.54 bits (410), Expect = 1.711e-39
Identity = 81/167 (48.50%), Postives = 114/167 (68.26%), Query Frame = -1
Query:  154 LNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 654
            +N G LA       FIPCTPKGC+EL+  +GV I G++AVV+GRS IVG P   LL  ++ATV+  H+ T + ++  ++ DI++ A G   +V+G W+KPGA+V+D   C ++   D     G +++GDV Y+EA   AS ITPVPGGVGPMTVAML+ +T++SAKR
Sbjct:  130 INAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVID---CGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKR 293          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: C1TC_PONAB (C-1-tetrahydrofolate synthase, cytoplasmic OS=Pongo abelii GN=MTHFD1 PE=2 SV=3)

HSP 1 Score: 162.155 bits (409), Expect = 2.235e-39
Identity = 81/167 (48.50%), Postives = 114/167 (68.26%), Query Frame = -1
Query:  154 LNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 654
            ++ G LA       FIPCTPKGC+EL+  +GV I G++AVV+GRS IVG P   LL  ++ATV+  H+ T N ++  ++ DI++ A G   +V+G W+KPGA+V+D   C ++   D     G +++GDV Y+EA   AS ITPVPGGVGPMTVAML+ +T++SAKR
Sbjct:  130 ISAGKLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTANLDEEVNKGDILVVATGRPEMVKGEWIKPGAIVID---CGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKR 293          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: C1TC_MOUSE (C-1-tetrahydrofolate synthase, cytoplasmic OS=Mus musculus GN=Mthfd1 PE=1 SV=3)

HSP 1 Score: 162.155 bits (409), Expect = 2.235e-39
Identity = 81/167 (48.50%), Postives = 116/167 (69.46%), Query Frame = -1
Query:  154 LNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 654
            ++ G LA       FIPCTPKGC+EL+  +GV+I G++AVV+GRS IVG P   LL  ++ATV+  H+ T N ++  ++ DI++ A G   +V+G W+KPGAVV+D   C ++   D +   G +++GDV Y+EA   AS ITPVPGGVGPMTVAML+ +T++SA+R
Sbjct:  130 VSAGKLARGDLNDCFIPCTPKGCLELIKEAGVQIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTANLDKEVNKGDILVVATGQPEMVKGEWIKPGAVVID---CGINYVPDDTKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAQR 293          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: FOLD_CHLPB (Bifunctional protein folD OS=Chlorobium phaeobacteroides (strain BS1) GN=folD PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 6.503e-39
Identity = 90/172 (52.33%), Postives = 113/172 (65.70%), Query Frame = -1
Query:  148 NIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLP-TSLLLQR---HHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKRAY 651
            N+G + +   +  FI CTP G +EL  R  +E  GK+ VVIGRSNIVG P  +L+LQ+    + TV+I H+ T N  +IT +ADIVIAA G    V    +KPGAVV+DVG   V+   DPS + GYRL+GDV YE   + AS ITPVPGGVGPMT+AMLL NTL S  R +
Sbjct:  125 NVGQMVLGNLDKCFISCTPYGILELFSRYSIETKGKHCVVIGRSNIVGKPMANLMLQKLKESNCTVTICHSATSNMPEITRQADIVIAAIGRPEYVTEDMIKPGAVVIDVGINRVE---DPSRKSGYRLVGDVDYENVNKKASAITPVPGGVGPMTIAMLLKNTLQSFMRVH 293          
BLAST of CN188900 vs. ExPASy Swiss-Prot
Match: FOLD_CHLPD (Bifunctional protein folD OS=Chlorobium phaeobacteroides (strain DSM 266) GN=folD PE=3 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 1.892e-38
Identity = 86/170 (50.59%), Postives = 114/170 (67.06%), Query Frame = -1
Query:  154 NIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLP-TSLLLQRHHAT---VSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDVSVDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 651
            N+G L M   +  F+ CTP G +ELL R  +E  GK+ VV+GRSNIVG P  +L++Q+  AT   V++ H+ T++    T +ADI+IAA G A  +    +KPGAVV+DVG   ++   DPS + GYRL+GDV Y+    LAS ITPVPGGVGPMT+AMLL NTL S +R
Sbjct:  125 NLGRLVMGHLDKCFVSCTPYGILELLDRYNIETKGKHCVVVGRSNIVGKPMANLMMQKLDATNCTVTVCHSATRDIPSFTKQADILIAALGKARFITADMVKPGAVVIDVGINRIE---DPSTKSGYRLVGDVDYDGVAALASAITPVPGGVGPMTIAMLLKNTLQSFRR 291          
The following BLAST results are available for this feature:
BLAST of CN188900 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
C1TC_SPOFR6.488e-4759.48C-1-tetrahydrofolate synthase, cytoplasmic OS=Spod... [more]
C1TC_DROME2.551e-4355.09C-1-tetrahydrofolate synthase, cytoplasmic OS=Dros... [more]
C1TM_YEAST8.207e-4251.79C-1-tetrahydrofolate synthase, mitochondrial OS=Sa... [more]
C1TC_SCHPO2.640e-4050.60C-1-tetrahydrofolate synthase, cytoplasmic OS=Schi... [more]
C1TC_RAT1.310e-3948.50C-1-tetrahydrofolate synthase, cytoplasmic OS=Ratt... [more]
C1TC_HUMAN1.711e-3948.50C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo... [more]
C1TC_PONAB2.235e-3948.50C-1-tetrahydrofolate synthase, cytoplasmic OS=Pong... [more]
C1TC_MOUSE2.235e-3948.50C-1-tetrahydrofolate synthase, cytoplasmic OS=Mus ... [more]
FOLD_CHLPB6.503e-3952.33Bifunctional protein folD OS=Chlorobium phaeobacte... [more]
FOLD_CHLPD1.892e-3850.59Bifunctional protein folD OS=Chlorobium phaeobacte... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001A02_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188900 ID=CN188900|Name=CN188900|organism=Citrus sinensis|type=EST|length=654bp
TTTTTTTTTTTTTTTATATAATCTACGTGCAGGTTAATTGATATTAGACT
TGAAAACTATGTTATTTCAATCATTGTGGAAGCAAAAAATAGTACAATTG
AATACAATTTTTTGAGAAGGATAATGCATTGGCAGTCAAGTAAAGCCGTA
TGCCCGTTTGGCAGAGTCGAGAGTGTTGGAGAGAAGCATAGCAACAGTCA
TGGGTCCAACTCCTCCAGGCACAGGGGTAATGACCGACGCTAACCTCATT
GCTTCTTCATAGCAAACATCTCCCATTAGACGATAACCATATTCACAGCT
TGGATCCACGCTTACATCAACAGGACAAGTTCCAACATCAAGAACAACAG
CACCAGGCTTTAGCCAACTCCCACGAACCAGATTAGCTACTCCTGCAGCT
GCGATCACGATATCAGCCTCACTGGTGATCTGCTCGGGGTTTTTTGTTAA
GGCGTGTACAATACTGACGGTTGCATGGTGTCTCTGCAACAATAAAGATG
TGGGCAATCCAACAATATTGCTTCTACCAATCACCACAGCATTCTTGCCC
ATTATCTCGACCCCCGATCTGATCAATAACTCAATGCAACCTTTTGGCGT
ACATGGAATAAACAGTGGTTCCCTTCCTCTCATGGCGAGATTCCCTATAT
TTAG
back to top