CN188889

Overview
NameCN188889
Unique NameCN188889
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length655
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1010..1664. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 1.799e-97
Identity = 177/202 (87.62%), Postives = 186/202 (92.08%), Query Frame = 2
Query:   47 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTE 652
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVE NRRALRELLFC PGALQY+SGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+ GT+ ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI++CA VTE
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVTE 202          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 4.008e-97
Identity = 176/202 (87.13%), Postives = 186/202 (92.08%), Query Frame = 2
Query:   47 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTE 652
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKR +SINVENVE NRR+LRELLFCTPGALQYLSGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+AGT  ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI++CA V+E
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSE 202          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.989e-96
Identity = 175/203 (86.21%), Postives = 186/203 (91.63%), Query Frame = 2
Query:   47 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTER 655
            M+ ++GKYADELI NA+YI TPGK ILAADESTGTIGKR  SINVENVESNRRALRELLF TPGAL YLSGVILFEETLYQKTA GKPFVD +K+GGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRC +YY AGARFAKWRAVLKIGP EPS LAI ENANGLARY IICQENGLVPIVEPEILVDG HDI++CA+V+ER
Sbjct:    1 MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSER 203          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 2.058e-93
Identity = 176/204 (86.27%), Postives = 184/204 (90.20%), Query Frame = 2
Query:   47 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGA-LQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTER 655
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNR+ALRELLF      LQYLSGVILFEETLYQKTAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEPS+ +I+ENA GLARYA+ICQENGLVPIVEPEILVDG HDI KCA +TER
Sbjct:    1 MSHFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDILKCAAITER 204          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 4.585e-93
Identity = 174/204 (85.29%), Postives = 182/204 (89.22%), Query Frame = 2
Query:   47 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAIN-ENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTER 655
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRL+SINVENVE+NRRALRELLF  P  LQYLSGVILFEETLYQ TAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC KYYEAGARFAKWRAVLKIGPNEPS   ++ ENA GLARYA+ICQENGLVPIVE EILVDG HDI+KCA +TER
Sbjct:    1 MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSIENAYGLARYAVICQENGLVPIVELEILVDGSHDIHKCAAITER 204          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 2.130e-90
Identity = 163/202 (80.69%), Postives = 180/202 (89.11%), Query Frame = 2
Query:   47 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTE 652
            MS F GKYADELIKNA YI TPGKGILAADESTGTIGKRL+SINVEN+E+NR+ALRELLF +P ALQYLSGVILFEETLYQK++ GKPFV++L+E  V+PGIKVDKG VELAGT+GETTTQG D L  RCQ+YY+AGARFAKWRAVLKIGPNEPS+L+I +NA GLARYAIICQENGLV  VEPEIL DG HDI KCA VTE
Sbjct:    1 MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVLFVEPEILTDGSHDIAKCAAVTE 202          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 304.679 bits (779), Expect = 2.788e-82
Identity = 153/202 (75.74%), Postives = 166/202 (82.18%), Query Frame = 2
Query:   47 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTE 652
            MS F  KY DELIK A YI TPG+GILAADEST TIGKR + INVEN ESNR+A RELLF +PG+   LSGVILFEETLYQKT+ GKPFVD+L E GV+PGIKVDKG V+LAGTNGETTTQGLD L  RCQ+YYEAGARFAKWRA  KIG  EPS L+I E+A  LARYAIICQENGLVPIVEPE+L  G HDI KCA VTE
Sbjct:    1 MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTE 202          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.309e-67
Identity = 134/200 (67.00%), Postives = 156/200 (78.00%), Query Frame = 2
Query:   65 KYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTP-GALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTER 655
            K+ADELI  A  I  PGKGILAADEST TIG R   IN+EN E NRRA RELL  T  G  +++ G+IL+EETLYQK A G+ F DVL+E  +  GIKVDKG V + GT+GET+TQGLDGLA+RC+KYYEAGARFAKWRAVLKI    N PSQL+I ENA+ LARYA ICQENGLVPIVEPEIL+DG H + + A+VTE+
Sbjct:    4 KFADELIATAKAIVAPGKGILAADESTNTIGARFKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYYEAGARFAKWRAVLKIDLAKNCPSQLSITENAHTLARYAAICQENGLVPIVEPEILMDGNHTVEQSAEVTEK 203          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 3.658e-66
Identity = 129/194 (66.49%), Postives = 149/194 (76.80%), Query Frame = 2
Query:   77 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTER 655
            EL +NA+ I  PGKG+LAADEST TIGKR ++IN+EN E NRRA RELLF T P   +++SGVILF ET+YQKT  GKPFV++L+E GVLPGIKVD G V L GT  E TTQGLD LAQRC +YY  G RFAKWR VLKI  + PS LA+ ENAN LARYA ICQ+NGLVPIVEPE+L DG HD+     VTE+
Sbjct:   15 ELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLKISSHNPSYLAMLENANVLARYAFICQQNGLVPIVEPEVLPDGDHDLETAQRVTEQ 208          
BLAST of CN188889 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.045e-65
Identity = 128/194 (65.98%), Postives = 151/194 (77.84%), Query Frame = 2
Query:   77 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTER 655
            EL + A  I + GKGILAADESTGT+GKRLS+I VENV+ NRR  R+LLF + P   + + GVI +EETLYQKT  G PFV ++K+ G++ GIKVDKGTV LAGT+GE+TTQGLDGLA+RC +Y + GA FAKWR VLKI  N PS LAI ENAN LARYA ICQ+NGLVPIVEPEIL DG HD+  C  VTE+
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEK 208          
The following BLAST results are available for this feature:
BLAST of CN188889 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_MAIZE1.799e-9787.62Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ4.008e-9787.13Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_SPIOL1.989e-9686.21Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA2.058e-9386.27Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_CICAR4.585e-9385.29Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA2.130e-9080.69Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH2.788e-8275.74Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_DICDI3.309e-6767.00Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]
ALF_ECHMU3.658e-6666.49Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]
ALF2_LAMJA4.045e-6565.98Fructose-bisphosphate aldolase, non-muscle type OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P14_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188889 ID=CN188889|Name=CN188889|organism=Citrus sinensis|type=EST|length=655bp
CGTCTCCCTCTAACAAAACAAATTTTCTATCTTCAAGTCGATCACCATGT
CTTGCTTCAAGGGCAAATACGCCGATGAGCTCATTAAAAATGCTGCCTAC
ATTGGCACCCCTGGAAAGGGTATCCTTGCTGCTGATGAGTCAACAGGCAC
CATTGGCAAGCGTCTATCCAGCATCAATGTTGAGAATGTTGAGTCAAACA
GGCGTGCTCTCCGCGAGCTCCTTTTCTGCACTCCCGGTGCCCTTCAGTAC
CTCAGTGGTGTCATCCTCTTCGAGGAGACCCTCTACCAGAAGACTGCTGC
TGGCAAGCCCTTTGTTGATGTCTTGAAGGAGGGGGGAGTCCTCCCTGGAA
TTAAGGTTGACAAGGGTACTGTTGAGCTTGCTGGTACCAATGGTGAGACC
ACCACCCAGGGTCTTGATGGCCTCGCCCAGCGCTGCCAGAAATACTATGA
AGCTGGTGCTCGTTTTGCCAAATGGCGTGCTGTTCTTAAGATTGGCCCTA
ATGAGCCTTCGCAGCTGGCCATCAATGAGAATGCCAATGGCCTGGCCCGA
TATGCTATCATCTGCCAGGAGAATGGCCTTGTTCCCATTGTTGAACCTGA
GATCCTTGTTGACGGTCCCCATGACATCAACAAGTGTGCTGATGTGACCG
AGCGT
back to top