CN188884

Overview
NameCN188884
Unique NameCN188884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188884_ssr99 microsatellite CN188884_ssr99:99..110. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2689 contig Csv1_Contig2689:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_ARATH (50S ribosomal protein L1, chloroplastic OS=Arabidopsis thaliana GN=RPL1 PE=1 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 3.230e-70
Identity = 127/145 (87.59%), Postives = 139/145 (95.86%), Query Frame = -1
Query:  331 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKLPS 765
            AD+VG DDLIEQIKGGFMEFDKLIASPDMMVKVA LGKILGPRGLMPNPKAGTVT NIPQAIEEFKKGKVE+RADKTGIVHIPFGK +F+E+DLLINFLAAVKS+E NKPKGAKGVYWKSA+ICSSMGPSI+LNI+EM+D+K P+
Sbjct:  200 ADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILGPRGLMPNPKAGTVTANIPQAIEEFKKGKVEFRADKTGIVHIPFGKVNFTEEDLLINFLAAVKSVETNKPKGAKGVYWKSAHICSSMGPSIKLNIREMIDFKPPT 344          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_SPIOL (50S ribosomal protein L1, chloroplastic OS=Spinacia oleracea GN=RPL1 PE=1 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 7.705e-64
Identity = 116/146 (79.45%), Postives = 131/146 (89.73%), Query Frame = -1
Query:  328 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKLPSN 765
            AD+VGG++LIEQIKGGFM+FDKLIA+ DMM KVASLG+ILGPRGLMP PKAGTVT N+ QA+EEFKKGKVE+R DKTGIVHIPFGK +F E+DLLIN  A +KS+E NKP GAKGVYWKSA+I SSMGPSIRLNI+EMLDYK PSN
Sbjct:  206 ADIVGGEELIEQIKGGFMDFDKLIATSDMMAKVASLGRILGPRGLMPTPKAGTVTPNVAQAVEEFKKGKVEFRVDKTGIVHIPFGKLNFEEEDLLINLFATIKSVETNKPTGAKGVYWKSAHISSSMGPSIRLNIREMLDYKPPSN 351          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_RHDSA (50S ribosomal protein L1, chloroplastic OS=Rhodomonas salina GN=rpl1 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.475e-48
Identity = 91/140 (65.00%), Postives = 113/140 (80.71%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            ADL G +DLI+ I  G ++FD+LIA+PDMM  +A LGK+LGPRGLMP+PK+GTVT +I +AI+EFKKGK+EYRADK+GIVHI FGK DFS +DLL N  A  +SI+ N+P G KG YWKS YICS+MGPSI+L+I E  D
Sbjct:   91 ADLAGAEDLIQNIMKGDLDFDRLIATPDMMPAIAKLGKVLGPRGLMPSPKSGTVTADIKEAIDEFKKGKLEYRADKSGIVHILFGKTDFSVEDLLANLEAVQESIDKNRPSGVKGRYWKSFYICSTMGPSIQLDISEFRD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_GUITH (50S ribosomal protein L1, chloroplastic OS=Guillardia theta GN=rpl1 PE=3 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.927e-48
Identity = 89/140 (63.57%), Postives = 113/140 (80.71%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            ADL G  DL++ I  G ++FD+LIA+PDMM  +A LGK+LGPRGLMP+PK+GTVT+++  AIEEFKKGK+EYRADK+GIVHI FGK +FS +DLL+N  A  +SI+ N+P G KG YWKS YICS+MGPSI+L+I E  D
Sbjct:   91 ADLAGSTDLVQDIMKGMLDFDRLIATPDMMPLIAKLGKVLGPRGLMPSPKSGTVTSDVKSAIEEFKKGKLEYRADKSGIVHISFGKTNFSVNDLLLNLEAVQESIDKNRPAGVKGKYWKSFYICSTMGPSIQLDISEFRD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_THEEB (50S ribosomal protein L1 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplA PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.118e-46
Identity = 86/143 (60.14%), Postives = 119/143 (83.22%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD+VG ++LI++I+ G M+FD LIA+PDMM +VA +G+ILGPRGLMP+PKAGTVT ++PQAI+EFK GKVE+RAD++GIVH+ FGKA FS +DLL+N  A  +SI+ N+P GAKG YW+S Y+ ++MGPSI+++I  + + KL
Sbjct:   91 ADVVGSEELIDEIQKGRMDFDLLIATPDMMPQVAKVGRILGPRGLMPSPKAGTVTFDLPQAIQEFKAGKVEFRADRSGIVHVLFGKASFSAEDLLVNLKALQESIDRNRPSGAKGRYWRSVYVAATMGPSIQVDINALRELKL 233          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_ANASP (50S ribosomal protein L1 OS=Anabaena sp. (strain PCC 7120) GN=rplA PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.252e-46
Identity = 85/143 (59.44%), Postives = 117/143 (81.82%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD+VG ++LI++I+ G M+FDKLIA+PD+M +VA LGK+LGPRGLMP+PK GTVT ++  AI EFK GK+E+RAD+TGIVH+ FGKA FS +DLL+N  A  ++I+ N+P GAKG YW++ Y+ ++MGPSIR++I  + DYKL
Sbjct:   92 ADVVGSEELIDEIQKGRMDFDKLIATPDVMPQVAKLGKMLGPRGLMPSPKGGTVTFDVASAIAEFKAGKLEFRADRTGIVHVMFGKASFSPEDLLVNLKALQETIDRNRPSGAKGRYWRTFYVSATMGPSIRVDINALRDYKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_ANAVT (50S ribosomal protein L1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplA PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 9.462e-46
Identity = 85/143 (59.44%), Postives = 116/143 (81.12%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD+ G ++LI++I+ G M+FDKLIA+PD+M +VA LGK+LGPRGLMP+PK GTVT +I  AI EFK GK+E+RAD+TGIVH+ FGKA FS +DLL+N  A  ++I+ N+P GAKG YW++ Y+ ++MGPSIR++I  + DYKL
Sbjct:   92 ADVFGSEELIDEIQKGRMDFDKLIATPDVMPQVAKLGKMLGPRGLMPSPKGGTVTFDIASAIAEFKAGKLEFRADRTGIVHVMFGKASFSPEDLLVNLKALQETIDRNRPSGAKGRYWRTFYVSATMGPSIRVDINALRDYKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_MICAN (50S ribosomal protein L1 OS=Microcystis aeruginosa (strain NIES-843) GN=rplA PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.236e-45
Identity = 85/143 (59.44%), Postives = 114/143 (79.72%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD+VG ++LIE+I  G M+F+ LIA+PDMM KVA LG+ LGPRGLMP+PK GTVTT++  AI EFK GK+E+RAD+TGIVH+ FGKA FS +DLL+N  A  ++++ N+P GAKG YW++ Y+ SSMGPSI+++I  + D KL
Sbjct:   92 ADIVGSEELIEEIAKGMMDFEVLIATPDMMPKVAKLGRQLGPRGLMPSPKGGTVTTDLTGAIAEFKAGKLEFRADRTGIVHVQFGKASFSAEDLLVNLKALQETVDRNRPSGAKGRYWRTVYVSSSMGPSIQVDISALRDLKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNR3 (50S ribosomal protein L1 OS=Synechococcus sp. (strain RCC307) GN=rplA PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.614e-45
Identity = 84/140 (60.00%), Postives = 110/140 (78.57%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            A+LVG ++L++ I GG M+FD LIA+PDMM KVA LG++LGPRGLMPNPK GTVTT++  AI EFK GK+E+RAD++GIVH+ FGKA FS DDLL N  +  ++++ NKP GAKG YWKS YI S+MGPS+ ++   + D
Sbjct:   91 AELVGDEELVDSIAGGQMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKTGTVTTDVTNAINEFKAGKLEFRADRSGIVHVQFGKASFSADDLLENLKSVQETVDRNKPSGAKGRYWKSLYITSTMGPSVEVDFSALQD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PROMS (50S ribosomal protein L1 OS=Prochlorococcus marinus (strain AS9601) GN=rplA PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.108e-45
Identity = 87/142 (61.27%), Postives = 110/142 (77.46%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            ADL G +DL+E I  G MEFD LIA+PDMM KVA LG++LGPRGLMPNPKAGTVT +I  AI+EFK GK+E+RADK GIVH+ FGKA F+++ L  N     +SI+ NKP GAKG YWK+ Y+ S+MGPS++L+I  + DY+
Sbjct:   91 ADLFGEEDLVESINKGNMEFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTNDIANAIKEFKAGKLEFRADKAGIVHVRFGKASFTKEALFDNLKTLQESIDKNKPSGAKGKYWKTFYVTSTMGPSVQLDINAVQDYQ 232          
The following BLAST results are available for this feature:
BLAST of CN188884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RK1_ARATH3.230e-7087.5950S ribosomal protein L1, chloroplastic OS=Arabido... [more]
RK1_SPIOL7.705e-6479.4550S ribosomal protein L1, chloroplastic OS=Spinaci... [more]
RK1_RHDSA3.475e-4865.0050S ribosomal protein L1, chloroplastic OS=Rhodomo... [more]
RK1_GUITH5.927e-4863.5750S ribosomal protein L1, chloroplastic OS=Guillar... [more]
RL1_THEEB1.118e-4660.1450S ribosomal protein L1 OS=Thermosynechococcus el... [more]
RL1_ANASP3.252e-4659.4450S ribosomal protein L1 OS=Anabaena sp. (strain P... [more]
RL1_ANAVT9.462e-4659.4450S ribosomal protein L1 OS=Anabaena variabilis (s... [more]
RL1_MICAN1.236e-4559.4450S ribosomal protein L1 OS=Microcystis aeruginosa... [more]
RL1_SYNR31.614e-4560.0050S ribosomal protein L1 OS=Synechococcus sp. (str... [more]
RL1_PROMS2.108e-4561.2750S ribosomal protein L1 OS=Prochlorococcus marinu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188884 ID=CN188884|Name=CN188884|organism=Citrus sinensis|type=EST|length=765bp
TTTTTTTTTTTTTTTTTACAAGAATGGAAAAATATTCAGTAGCCATTCAA
GTAATTTTACAGAAAAAAAAATTGCGGTAATGAACCTGAGAGTGGGCGAT
AATAATAATATCTTTTTCAGTACGGAAAAAAGCCATGCTGTATGCATTTT
TCCTTTTTTTTATTTGCTACAATCTCATCCACATTGATAATCAAGATCTC
CTCACCTCACCATAATTCACTCTCCTACAACTTTTGCCAAGCAGTGGCAA
GCCCTGGCATGGGTATCAAAGAGGCTGACTGAACAGTTAAAGCTATCATT
TACAAAATTTAGTTATGTCATTTAGAAATTTGATGGAAGCTTGTAATCGA
GCATTTCTTTTATGTTTAATCGAATGGAAGGTCCCATTGATGAGCAAATG
TAAGCACTTTTCCAGTACACTCCTTTGGCCCCTTTTGGCTTGTTTGCTTC
AATTGATTTAACAGCAGCAAGGAAGTTTATGAGGAGGTCATCTTCAGAAA
AATCAGCTTTCCCAAAAGGTATGTGGACAATCCCAGTTTTATCTGCTCTA
TATTCAACTTTTCCCTTCTTGAATTCTTCTATGGCCTGAGGTATGTTAGT
TGTAACAGTACCAGCTTTAGGATTTGGCATGAGTCCCCGTGGTCCAAGAA
TTTTTCCTAGGCTGGCAACCTTAACCATCATATCTGGTGAAGCAATTAGC
TTGTCGAACTCCATGAATCCTCCTTTTATTTGTTCAATCAAGTCATCACC
ACCAACCAAATCTGC
back to top