CN188649

Overview
NameCN188649
Unique NameCN188649
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length548
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188649_ssr94 microsatellite CN188649_ssr94:94..105. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CN188649 vs. ExPASy Swiss-Prot
Match: 21KD_DAUCA (21 kDa protein OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.545e-20
Identity = 47/82 (57.32%), Postives = 62/82 (75.61%), Query Frame = -3
Query:  298 SQSVRELAHVGRAVGQDFTWPMSNVQTWVSAALTDENTCLEGFDGRFMDGNVKVAIGRRVTNVAQVTSNALALVNRFAGGHQ 543
            S+S  E+ ++  A G DFT+ MSNV+TWVSAALTDE TC++GF G+ MDG +K ++  +V  VA+VTSNALALVN FA  H+
Sbjct:  111 SRSCDEMKNLSHAKGNDFTFRMSNVETWVSAALTDETTCMDGFAGKGMDGKIKESVRAQVVAVARVTSNALALVNNFAAKHK 192          
The following BLAST results are available for this feature:
BLAST of CN188649 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
21KD_DAUCA3.545e-2057.3221 kDa protein OS=Daucus carota PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006I03_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006I03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188649 ID=CN188649; Name=CN188649; organism=Citrus sinensis; type=EST; length=548bp
TTTTTTTTTTTTTTTTTACCCCCCTCTTTTTTTATTTTATTTAAACAAAA
CTCAAGTATCTTAAACCATGGAAAAAAAACAACAACCACCGCCGCAGCAG
CAGCAAAACACAAACTCTTATGTTTAAATACCGACCGGACTTTTTGTTGG
GTGCCCCAAAAACCAAACTTTCTTATATGAGACAGAAACTAAACTAACCC
CCAACCTAAGGGATATCATATTGAGATACCCTATTATACAGAAGACAGCA
AAGGTCCCCTTAAACGAAATCTAAGGCTTCCCGGTGACTGCTGCAACTTG
GTGCCCACCGGCGAATCGATTAACCAAAGCAAGAGCGTTACTAGTGACTT
GGGCAACATTTGTGACCCTTCTCCCGATCGCAACCTTTACATTTCCGTCC
ATGAAACGACCATCAAAACCCTCTAAGCAAGTGTTCTCATCAGTTAGTGC
GGCACTAACCCAAGTCTGCACATTACTCATGGGCCACGTAAAGTCCTGGC
CGACAGCTCGTCCCACATGGGCAAGCTCCCTGACGGATTGACTAAATC
back to top