CN181495

Overview
NameCN181495
Unique NameCN181495
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length661
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig239 contig Csv1_Contig239:479..1139. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP11_ARATH (Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1 PE=1 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.636e-64
Identity = 114/143 (79.72%), Postives = 126/143 (88.11%), Query Frame = -1
Query:  233 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 661
            AQLLGS VACL+LKF T G    AF LS+GVG  NA VFEIVMTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF GASMNPAV+FGPA+VSW+W NHWVYW GPL+GGG+AG++YE FFIN +HEQLPTT+Y
Sbjct:  109 AQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTTDY 251          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP11_ORYSJ (Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.889e-62
Identity = 114/143 (79.72%), Postives = 125/143 (87.41%), Query Frame = -1
Query:  233 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 661
            AQLLGSTVAC LL+F T G  T  F L+ GV  W A+V EIVMTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANIL GGAFDGASMNPAVSFGPALVSWSW++ WVYWVGPLIGGGLAG++YE  FI+ +HEQLPTT+Y
Sbjct:  109 AQLLGSTVACFLLRFSTGGLATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTTDY 250          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP12_ARATH (Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2)

HSP 1 Score: 237.654 bits (605), Expect = 4.208e-62
Identity = 113/144 (78.47%), Postives = 127/144 (88.19%), Query Frame = -1
Query:  233 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTTEY 661
            AQLLGS  AC LL F T G+   AF LS+GVG+ NA+VFEIVMTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF GASMNPAV+FGPA+VSW+W NHWVYW GPLIGGGLAGI+Y+F FI++ +HEQLPTT+Y
Sbjct:  110 AQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTTDY 253          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP11_MAIZE (Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 9.374e-62
Identity = 113/143 (79.02%), Postives = 123/143 (86.01%), Query Frame = -1
Query:  233 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 661
            AQLLGSTVAC LL+F T GQ T  F L+ GV  W A+V EIVMTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANIL GGAFDGASMNPAVSFGPALVSW W   WVYWVGPLIGGGLAG++YE  FI+ +HEQLP+T+Y
Sbjct:  109 AQLLGSTVACFLLRFSTGGQATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISHTHEQLPSTDY 250          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP12_ORYSJ (Probable aquaporin TIP1-2 OS=Oryza sativa subsp. japonica GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 6.718e-60
Identity = 109/144 (75.69%), Postives = 122/144 (84.72%), Query Frame = -1
Query:  233 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTTEY 661
            AQLLGS VACLLLK  T G    AF+LS+GVGAWNAVVFEIVMTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFDGASMNPAVSFGPA+V+  WDNHWVYW+GP +G  +A ++Y+  FI Q  H+QLPT +Y
Sbjct:  109 AQLLGSVVACLLLKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWDNHWVYWLGPFVGAAIAALIYDIIFIGQRPHDQLPTADY 252          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP1_MEDTR (Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 3.686e-58
Identity = 110/143 (76.92%), Postives = 120/143 (83.92%), Query Frame = -1
Query:  233 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 661
            AQLLGS VA  LL FVT   +  AF LS GVG   A+V EIVMTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANIL GGAF GASMNPAVSFGPA+VSWSW NHWVYW GPLIGGG+AG+VYE  FIN +HEQLPTT+Y
Sbjct:  109 AQLLGSIVASALLVFVT-ASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTTDY 250          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP1_MEDSA (Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 1.073e-57
Identity = 109/143 (76.22%), Postives = 119/143 (83.22%), Query Frame = -1
Query:  233 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 661
            AQLLGS V   LL FVT   +  AF LS GVG   A+V EIVMTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANIL GGAF GASMNPAVSFGPA+VSWSW NHWVYW GPLIGGG+AG+VYE  FIN +HEQLPTT+Y
Sbjct:  108 AQLLGSIVCSALLVFVT-ASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTTDY 249          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP12_MAIZE (Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 6.952e-57
Identity = 108/142 (76.06%), Postives = 119/142 (83.80%), Query Frame = -1
Query:  239 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTT 661
            AQLLGS VACLLLK  T G    AF+LS+GVGA NAVV E+VMTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFDGASMNPAVSFGPA+V+  W+NHWVYWVGPL G  +A +VY+  FI Q  H+QLPTT
Sbjct:  109 AQLLGSVVACLLLKIATGGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWENHWVYWVGPLAGAAIAALVYDIIFIGQRPHQQLPTT 250          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP13_ARATH (Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3 PE=1 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.642e-56
Identity = 105/144 (72.92%), Postives = 118/144 (81.94%), Query Frame = -1
Query:  233 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI-NQSHEQLPTTEY 661
            AQLLG+ VACLLLK  T G  T+AF+LS GV  WNAVVFEIVMTFGLVYTVYATA+DPKKG +G IAP+AIG IVGANIL GGAFDGASMNPAVSFGPA+VSW W NHWVYWVGP IG  +A IVY+  FI +  HE LP+ ++
Sbjct:  109 AQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMNPAVSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYDTIFIGSNGHEPLPSNDF 252          
BLAST of CN181495 vs. ExPASy Swiss-Prot
Match: TIP2_TOBAC (Probable aquaporin TIP-type RB7-18C OS=Nicotiana tabacum PE=2 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 7.704e-48
Identity = 94/142 (66.20%), Postives = 109/142 (76.76%), Query Frame = -1
Query:  236 AQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTE 661
            AQLLGSTVACLLLK+VTNG       +++G+  +  VV EI++TF LVYTVYATA DPKKGSLGTIAPIAIGFIVGANILA G F G SMNPA SFGPA+V+  +  +W+YW GPLIGGGLAG +Y   FI   H  LPT+E
Sbjct:  107 AQLLGSTVACLLLKYVTNGLAVPTHGVAAGLNGFQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWAGPLIGGGLAGFIYGDVFIG-CHTPLPTSE 247          
The following BLAST results are available for this feature:
BLAST of CN181495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 148
Match NameE-valueIdentityDescription
TIP11_ARATH2.636e-6479.72Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1... [more]
TIP11_ORYSJ1.889e-6279.72Probable aquaporin TIP1-1 OS=Oryza sativa subsp. j... [more]
TIP12_ARATH4.208e-6278.47Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2... [more]
TIP11_MAIZE9.374e-6279.02Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1[more]
TIP12_ORYSJ6.718e-6075.69Probable aquaporin TIP1-2 OS=Oryza sativa subsp. j... [more]
TIP1_MEDTR3.686e-5876.92Probable aquaporin TIP-type OS=Medicago truncatula... [more]
TIP1_MEDSA1.073e-5776.22Probable aquaporin TIP-type OS=Medicago sativa GN=... [more]
TIP12_MAIZE6.952e-5776.06Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1[more]
TIP13_ARATH2.642e-5672.92Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3... [more]
TIP2_TOBAC7.704e-4866.20Probable aquaporin TIP-type RB7-18C OS=Nicotiana t... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A13_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A13, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181495 ID=CN181495|Name=CN181495|organism=Citrus sinensis|type=EST|length=661bp
GAGGGGTTAATGAAATAGACATCAAGCCAATTGAAGCGAGAGTAGAAAGA
CAAAGCCATAGCCTGGGACTCCATAATTATCGCGATACAATAATCCAGCA
GCTCATGACGATGGAAACAGATCAACGGCCATAAATTAAACACAAATTAA
AAATAAAAAGAAAGAACCTCGGTAAAAGCAAATTAAATACAACATCCGTG
CAAACTCACATAGATGGCAAGCTTTTAGCTTAGTACTCGGTTGTTGGGAG
CTGCTCATGCGACTGGTTAATGAAGAAGAACTCGTAGACGATGCCAGCTA
GCCCACCACCGATGAGTGGCCCGACCCAGTAGACCCAGTGGTTGTCCCAG
CTCCAGCTCACCAAAGCTGGCCCGAATGACACTGCTGGGTTCATTGAAGC
TCCATCAAACGCCCCGCCCGCCAAGATGTTGGCTCCTACAATGAAACCAA
TTGCAATTGGTGCAATTGTCCCCAAGCTTCCCTTCTTTGGGTCCAGGGCT
GTGGCATACACTGTGTACACTAGTCCGAATGTCATCACGATCTCGAAAAC
GACTGCGTTCCATGCACCAACTCCAGATGAGAGAGCAAAAGCAGATGTGG
TCTGGCCGTTGGTAACGAACTTAAGAAGCAAGCATGCGACGGTGGATCCA
AGAAGCTGGGC
back to top