CN181492

Overview
NameCN181492
Unique NameCN181492
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2605 contig Csv1_Contig2605:156..742. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 5.519e-55
Identity = 102/116 (87.93%), Postives = 111/116 (95.69%), Query Frame = -1
Query:  215 AAEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATAS 562
            AAEEGQVIGCH VEAWNEQLQK N+TK L+VVDFTASWCGPCRFIAPFLAELAKKLPNV FLKVDVDELK+VA +WAVE+MPTFMFLKEGKI+DKVVG+KK+ELQQTIAKH+ATAS
Sbjct:    2 AAEEGQVIGCHTVEAWNEQLQKGNDTKGLIVVDFTASWCGPCRFIAPFLAELAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKHMATAS 117          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.348e-52
Identity = 96/113 (84.96%), Postives = 106/113 (93.81%), Query Frame = -1
Query:  224 AAEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLA 562
            A+EEGQVI CH VE WNEQLQK+NE+K LVVVDFTASWCGPCRFIAPF A+LAKKLPNVLFLKVD DELKSVA+DWA++AMPTFMFLKEGKI+DKVVG+KK+ELQ TIAKHLA
Sbjct:    2 ASEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA 114          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.653e-49
Identity = 93/115 (80.87%), Postives = 104/115 (90.43%), Query Frame = -1
Query:  215 AEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATAS 559
            AEEGQVIG H V+AWNE LQK  + K+L+VVDFTASWCGPC+FIA F AELAKK+P V FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVG+KK+ELQQTIAKH+++ S
Sbjct:    2 AEEGQVIGVHTVDAWNEHLQKGIDDKKLIVVDFTASWCGPCKFIASFYAELAKKMPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHISSTS 116          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH1_TOBAC (Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.745e-46
Identity = 84/119 (70.59%), Postives = 104/119 (87.39%), Query Frame = -1
Query:  215 EMAAAEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATAS 571
            +  ++EEGQV GCH VE WNE  +K  ETK+LVVVDFTASWCGPCRFIAP LA++AKK+P+V+FLKVDVDELK+V+ +W+VEAMPTF+F+K+GK VD+VVG+KKEELQQTI KH A A+
Sbjct:    5 DATSSEEGQVFGCHKVEEWNEYFKKGVETKKLVVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKHAAPAT 123          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH5_ARATH (Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TRX5 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.042e-37
Identity = 66/110 (60.00%), Postives = 92/110 (83.64%), Query Frame = -1
Query:  230 AEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKH 559
            A EG+VI CH +E WNE+++ +NE+K+L+V+DFTASWC PCRFIAP  AE+AKK  NV+F K+DVDEL++VA ++ VEAMPTF+F+KEG I+D+VVG+ K+E+ + + KH
Sbjct:    2 AGEGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKH 111          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH2_BRANA (Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 4.393e-36
Identity = 69/118 (58.47%), Postives = 93/118 (78.81%), Query Frame = -1
Query:  212 AAEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKK-LPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA 562
            AAEEGQVIGCH ++ W  QL  + ++ +L+V+DFTASWC PCR IAP  A+LAKK + + +F KVDVDEL++VA ++ VEAMPTF+ +K+G +VDKVVG++KE+L  TIAKH   A+A
Sbjct:    2 AAEEGQVIGCHEIDVWAVQLDTAKQSNKLIVIDFTASWCPPCRMIAPVFADLAKKFMSSAIFFKVDVDELQNVAQEFGVEAMPTFVLIKDGNVVDKVVGARKEDLHATIAKHTGVATA 119          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH_ORYSJ (Thioredoxin H-type OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 7.493e-36
Identity = 69/117 (58.97%), Postives = 89/117 (76.07%), Query Frame = -1
Query:  212 AAEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA 562
            AAEEG VI CH  + ++ Q+ K+ E  ++V++DFTASWCGPCRFIAP  AE AKK P  +FLKVDVDELK VA  + VEAMPTF+F+K+G   DKVVG++K++LQ TI KH+   +A
Sbjct:    2 AAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAA 118          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH_ORYSI (Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 7.493e-36
Identity = 69/117 (58.97%), Postives = 89/117 (76.07%), Query Frame = -1
Query:  212 AAEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA 562
            AAEEG VI CH  + ++ Q+ K+ E  ++V++DFTASWCGPCRFIAP  AE AKK P  +FLKVDVDELK VA  + VEAMPTF+F+K+G   DKVVG++K++LQ TI KH+   +A
Sbjct:    2 AAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAA 118          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH_PICMA (Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.278e-35
Identity = 66/113 (58.41%), Postives = 86/113 (76.11%), Query Frame = -1
Query:  215 EGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATAS 553
            EG V  CH  E W  +LQ++ +TK+LV VDFTA+WCGPCR I P   EL+KK P + FLKVDVDEL+ VA +W VEAMPTF+F+K+GK VDKVVG+KK++L++ +A   A A+
Sbjct:    3 EGNVFACHSTEGWRSKLQEAIDTKRLVAVDFTATWCGPCRVIGPVFVELSKKFPEIFFLKVDVDELRDVAQEWDVEAMPTFIFIKDGKAVDKVVGAKKDDLERKVAALAAAAT 115          
BLAST of CN181492 vs. ExPASy Swiss-Prot
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.847e-35
Identity = 65/110 (59.09%), Postives = 89/110 (80.91%), Query Frame = -1
Query:  230 AEEGQVIGCHPVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKH 559
            AEE QVI CH V+ WNE+ QK+ ++ +L+V+DFTASWCGPCR I P+++ELAKK P+V F KVDVD+LK VA ++ VEAMP+F+ LKEG+ V+++VG++K+EL   IA H
Sbjct:    2 AEEAQVIACHTVQEWNEKFQKAKDSGKLIVIDFTASWCGPCRVITPYVSELAKKFPHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKIAVH 111          
The following BLAST results are available for this feature:
BLAST of CN181492 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 110
Match NameE-valueIdentityDescription
TRXH_RICCO5.519e-5587.93Thioredoxin H-type OS=Ricinus communis PE=3 SV=1[more]
TRXH1_ARATH3.348e-5284.96Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TR... [more]
TRXH2_TOBAC2.653e-4980.87Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=... [more]
TRXH1_TOBAC2.745e-4670.59Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=... [more]
TRXH5_ARATH3.042e-3760.00Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TR... [more]
TRXH2_BRANA4.393e-3658.47Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE... [more]
TRXH_ORYSJ7.493e-3658.97Thioredoxin H-type OS=Oryza sativa subsp. japonica... [more]
TRXH_ORYSI7.493e-3658.97Thioredoxin H-type OS=Oryza sativa subsp. indica G... [more]
TRXH_PICMA1.278e-3558.41Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 S... [more]
TRXH_FAGES2.847e-3559.09Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A12_f Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181492 ID=CN181492|Name=CN181492|organism=Citrus sinensis|type=EST|length=604bp
AACAACAAAGAACGATCTACCCCAAATATGAAATTAAATTATTGTAAAGA
CCACAGTATGAGCTTCATAGAACAGTAAATTACGGAATATTCAAACACAC
AAACAAACACAATCCCATAACCACTCTAATAAGTAAATTACAGACTGATA
GCATATATTGAGGTCTATAGCCTCTAAAGCCAAAAGGCAGGAGGATAGTT
ATAACTTATTAGGCAGAGGCAGTTGCCAGATGCTTGGCAATAGTCTGCTG
CAGTTCCTCTTTCTTTGATCCAACCACCTTGTCCACAATCTTCCCCTCTT
TCAGGAACATGAAAGTTGGCATGGCCTCCACTGCCCAGTCAGTGGCAACA
CTCTTCAGTTCATCCACATCAACCTTCAGAAACAGGACATTAGGCAGTTT
CTTGGCCAGCTCTGCCAAGAAAGGAGCAATGAAACGGCATGGTCCGCACC
ACGAAGCAGTGAAATCAACAACAACCAGCTGTTTGGTTTCATTGCTCTTC
TGGAGCTGCTCGTTCCAGGCCTCAACGGGGTGGCACCCGATGACTTGTCC
CTCTTCTGCTGCTGCCATTTCTGCTTTCCGCGGTTATTACCACCACTACT
CCAC
back to top