CN181487

Overview
NameCN181487
Unique NameCN181487
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length669
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9884 contig Csv1_Contig9884:40..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 5.347e-105
Identity = 180/202 (89.11%), Postives = 190/202 (94.06%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F GKAV L+PS +E++  GR++MRKT +K+   SSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVK
Sbjct:   13 FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVK 214          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 6.984e-105
Identity = 179/202 (88.61%), Postives = 191/202 (94.55%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVK
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVK 214          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 9.121e-105
Identity = 179/202 (88.61%), Postives = 191/202 (94.55%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVK
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVK 213          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 3.466e-104
Identity = 178/200 (89.00%), Postives = 187/200 (93.50%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F G+AV L+PS +E+S  GRI+MRK  +KS  S SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVK
Sbjct:   13 FAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVK 212          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 3.466e-104
Identity = 176/200 (88.00%), Postives = 188/200 (94.00%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F G+AV L+PS  E++  GR+SMRKT +K V+S SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVK
Sbjct:   13 FAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVK 212          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 4.527e-104
Identity = 177/198 (89.39%), Postives = 187/198 (94.44%), Query Frame = 2
Query:   74 GKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            G+AV L+P+  E+    + +MRKT SKSVSSGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLADDPEAFAELKVK
Sbjct:    5 GQAVKLSPNAPEIQGNAKFTMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVK 202          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 7.722e-104
Identity = 177/202 (87.62%), Postives = 191/202 (94.55%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F GKAV L+PS +E++  G+++MRKT +K+  +SSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVK
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVK 214          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB27_TOBAC (Chlorophyll a-b binding protein 7, chloroplastic OS=Nicotiana tabacum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.008e-103
Identity = 178/202 (88.12%), Postives = 189/202 (93.56%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F G AV L+PS +E++  G+  MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK
Sbjct:   13 FAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 214          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 1.720e-103
Identity = 177/202 (87.62%), Postives = 190/202 (94.06%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F GKAV L+PS +E++  G+++MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGEV DPLYPGGSFDPLGLA+DPEAFAELKVK
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVK 213          
BLAST of CN181487 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 8.537e-103
Identity = 177/202 (87.62%), Postives = 188/202 (93.07%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVK 667
            F GKAV  +PS +E++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTA LSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVK
Sbjct:   13 FAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVK 214          
The following BLAST results are available for this feature:
BLAST of CN181487 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 76
Match NameE-valueIdentityDescription
CB2G_SOLLC5.347e-10589.11Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC6.984e-10588.61Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC9.121e-10588.61Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB2B_SOLLC3.466e-10489.00Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB22_TOBAC3.466e-10488.00Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB21_CUCSA4.527e-10489.39Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB25_TOBAC7.722e-10487.62Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB27_TOBAC1.008e-10388.12Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB25_NICPL1.720e-10387.62Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB25_PETSP8.537e-10387.62Chlorophyll a-b binding protein 91R, chloroplastic... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A09_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181487 ID=CN181487|Name=CN181487|organism=Citrus sinensis|type=EST|length=669bp
GAGGCCAGCTTCTGCTTCTCAATTAAATTCCTCAATGGCAACCTCAACAA
TGGCTCTCTCCTCATCATTCGTCGGCAAGGCCGTGAACCTCGCCCCTTCA
GGCAATGAGCTGAGCAATGGTGGCCGCATCTCCATGCGTAAAACCGGGAG
CAAGTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCCGGACAGAGTCAAGT
ACTTGGGCCCACTCTCTGGCGAGCCCCCAAGCTACTTGACTGGTGAGTTC
CCTGGCGACTACGGTTGGGACACTGCCGGGCTTTCAGCTGACCCAGAAAC
CTTTGCCAAGAACCGTGAACTCGAAGTCATCCACTGCAGATGGGCCATGT
TGGGAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCAACGGAGTC
AAGTTCGGTGAGGCTGTGTGGTTCAAGGCGGGAGCTCAGATCTTCAGCGA
GGGCGGGCTTGACTACTTGGGAAACCCAAGCTTGATCCACGCCCAGAGCA
TCTTGGCCATCTGGGCTTGCCAGGTGGTCTTGATGGGAGCCGTTGAGGGT
TACAGAATTGCTGGAGGGCCGCTCGGTGAAGTGACTGACCCATTGTACCC
AGGTGGCAGCTTTGATCCATTGGGTTTGGCTGATGACCCGGAGGCTTTTG
CTGAGCTCAAGGTTAAGGA
back to top