CN181483

Overview
NameCN181483
Unique NameCN181483
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length341
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5956 contig Csv1_Contig5956:138..477. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA_TOBAC (Proliferating cell nuclear antigen OS=Nicotiana tabacum GN=PCNA PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 7.233e-51
Identity = 93/101 (92.08%), Postives = 96/101 (95.05%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALVALLLRSEGFEHYRCDRNISMGMNL N++KMLKCAGNDDIITLKADDGSDT T MFESPTQDKIADFEMKLMDID EHLGIP AEYHA
Sbjct:   35 FSLQAMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLANMAKMLKCAGNDDIITLKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPEAEYHA 135          

HSP 2 Score: 30.8018 bits (68), Expect = 7.233e-51
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 2
Query:    5 NDANFDCSATGF 40
            NDANFDCSATGF
Sbjct:   24 NDANFDCSATGF 35          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA_PEA (Proliferating cell nuclear antigen OS=Pisum sativum GN=PCNA PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.229e-50
Identity = 91/101 (90.10%), Postives = 97/101 (96.04%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALVALLLRSEGFEHYRCDRN+SMGMNLNN++KMLKCAGNDDIIT+KADDGSDT T MFESPTQDKI+DFEMKLMDID EHLGIP AEYHA
Sbjct:   35 FSLQAMDSSHVALVALLLRSEGFEHYRCDRNLSMGMNLNNMAKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKISDFEMKLMDIDSEHLGIPEAEYHA 135          

HSP 2 Score: 29.6462 bits (65), Expect = 1.229e-50
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 2
Query:    5 NDANFDCSATGF 40
            NDANFDCS+TGF
Sbjct:   24 NDANFDCSSTGF 35          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA1_DAUCA (Proliferating cell nuclear antigen OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.602e-50
Identity = 91/101 (90.10%), Postives = 96/101 (95.05%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALVA+LLRSEGFEHYRCDRNISMGMNL N++KMLKCAGNDDIIT+KADDGSDT T MFESPTQDKIADFEMKLMDID EHLGIP AEYHA
Sbjct:   35 FSLQAMDSSHVALVAVLLRSEGFEHYRCDRNISMGMNLGNMAKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPEAEYHA 135          

HSP 2 Score: 30.8018 bits (68), Expect = 1.602e-50
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 2
Query:    5 NDANFDCSATGF 40
            NDANFDCSATGF
Sbjct:   24 NDANFDCSATGF 35          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA2_ARATH (Proliferating cell nuclear antigen 2 OS=Arabidopsis thaliana GN=At2g29570 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.024e-49
Identity = 90/101 (89.11%), Postives = 96/101 (95.05%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALV+LLLRSEGFEHYRCDRN+SMGMNL N+SKMLKCAGNDDIIT+KADDGSDT T MFESPTQDKIADFEMKLMDID EHLGIP AEYH+
Sbjct:   35 FSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHS 135          

HSP 2 Score: 29.261 bits (64), Expect = 1.024e-49
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 2
Query:    5 NDANFDCSATGF 40
            NDANFDCS TGF
Sbjct:   24 NDANFDCSTTGF 35          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA_CATRO (Proliferating cell nuclear antigen OS=Catharanthus roseus PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.739e-49
Identity = 92/101 (91.09%), Postives = 96/101 (95.05%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALVALLLRSEGFEHYRCDRN SMGMNLNN++KMLKCAGNDDIITLKADDGSDT T MFESPTQDKI+DFEMKLMDID EHLGIP AEYHA
Sbjct:   35 FSLQAMDSSHVALVALLLRSEGFEHYRCDRNPSMGMNLNNMAKMLKCAGNDDIITLKADDGSDTVTFMFESPTQDKISDFEMKLMDIDSEHLGIPEAEYHA 135          

HSP 2 Score: 26.9498 bits (58), Expect = 1.739e-49
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 2
Query:    8 DANFDCSATGF 40
            DANFDCSA+GF
Sbjct:   25 DANFDCSASGF 35          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA1_ARATH (Proliferating cellular nuclear antigen 1 OS=Arabidopsis thaliana GN=PCNA PE=1 SV=2)

HSP 1 Score: 187.578 bits (475), Expect = 2.268e-49
Identity = 89/101 (88.12%), Postives = 95/101 (94.06%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALV+LLLRSEGFEHYRCDRN+SMGMNL N+SKMLKCAGNDDIIT+KADDG DT T MFESPTQDKIADFEMKLMDID EHLGIP AEYH+
Sbjct:   35 FSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHS 135          

HSP 2 Score: 29.6462 bits (65), Expect = 2.268e-49
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 2
Query:    5 NDANFDCSATGF 40
            NDANFDCS+TGF
Sbjct:   24 NDANFDCSSTGF 35          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA_SOYBN (Proliferating cell nuclear antigen (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 5.264e-49
Identity = 92/101 (91.09%), Postives = 97/101 (96.04%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNN++KMLKCAGNDDIIT+KADDGSDT T MFESPTQDKI+DFEMKLMDID EHLGIP AEYHA
Sbjct:    5 FSLQAMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNMAKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKISDFEMKLMDIDSEHLGIPEAEYHA 105          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA_BRANA (Proliferating cell nuclear antigen OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.449e-48
Identity = 88/101 (87.13%), Postives = 94/101 (93.07%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALV+LLLRSEGFEHYRCDRN+SMGMNL N+SKMLKCAGNDDIIT+KADDG DT T MFESP QDKIADFEMKLMDID EHLGIP AEYH+
Sbjct:   35 FSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPKQDKIADFEMKLMDIDSEHLGIPDAEYHS 135          

HSP 2 Score: 29.261 bits (64), Expect = 1.449e-48
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 2
Query:    5 NDANFDCSATGF 40
            NDANFDCS TGF
Sbjct:   24 NDANFDCSTTGF 35          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA_POPNI (Proliferating cell nuclear antigen OS=Populus nigra GN=PCNA PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 4.182e-48
Identity = 91/101 (90.10%), Postives = 94/101 (93.07%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQSMDSSHVALVALLL+SEGFEHYRCDRN SMGMNL N+SKMLKCAGNDDIIT+K DDGSDT T MFESPTQDKIADFEMKLMDID EHLGIP AEYHA
Sbjct:   35 FSLQSMDSSHVALVALLLKSEGFEHYRCDRNTSMGMNLGNMSKMLKCAGNDDIITIKGDDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPEAEYHA 135          

HSP 2 Score: 23.8682 bits (50), Expect = 4.182e-48
Identity = 9/12 (75.00%), Postives = 11/12 (91.67%), Query Frame = 2
Query:    5 NDANFDCSATGF 40
            NDANFD S++GF
Sbjct:   24 NDANFDFSSSGF 35          
BLAST of CN181483 vs. ExPASy Swiss-Prot
Match: PCNA_MAIZE (Proliferating cell nuclear antigen OS=Zea mays GN=PCNA PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 4.183e-48
Identity = 87/101 (86.14%), Postives = 95/101 (94.06%), Query Frame = 3
Query:   39 FSLQSMDSSHVALVALLLRSEGFEHYRCDRNISMGMNLNNVSKMLKCAGNDDIITLKADDGSDTATLMFESPTQDKIADFEMKLMDIDREHLGIPHAEYHA 341
            FSLQ+MDSSHVALVALLLR+EGFEHYRCDRN+SMGMNLNN++KML+CAGNDDIIT+KADDGSDT T MFESP QDKIADFEMKLMDID EHLGIP +EY A
Sbjct:   35 FSLQAMDSSHVALVALLLRAEGFEHYRCDRNLSMGMNLNNMAKMLRCAGNDDIITIKADDGSDTVTFMFESPKQDKIADFEMKLMDIDSEHLGIPDSEYQA 135          

HSP 2 Score: 29.261 bits (64), Expect = 4.183e-48
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 2
Query:    5 NDANFDCSATGF 40
            NDANFDCS TGF
Sbjct:   24 NDANFDCSGTGF 35          
The following BLAST results are available for this feature:
BLAST of CN181483 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
PCNA_TOBAC7.233e-5192.08Proliferating cell nuclear antigen OS=Nicotiana ta... [more]
PCNA_PEA1.229e-5090.10Proliferating cell nuclear antigen OS=Pisum sativu... [more]
PCNA1_DAUCA1.602e-5090.10Proliferating cell nuclear antigen OS=Daucus carot... [more]
PCNA2_ARATH1.024e-4989.11Proliferating cell nuclear antigen 2 OS=Arabidopsi... [more]
PCNA_CATRO1.739e-4991.09Proliferating cell nuclear antigen OS=Catharanthus... [more]
PCNA1_ARATH2.268e-4988.12Proliferating cellular nuclear antigen 1 OS=Arabid... [more]
PCNA_SOYBN5.264e-4991.09Proliferating cell nuclear antigen (Fragment) OS=G... [more]
PCNA_BRANA1.449e-4887.13Proliferating cell nuclear antigen OS=Brassica nap... [more]
PCNA_POPNI4.182e-4890.10Proliferating cell nuclear antigen OS=Populus nigr... [more]
PCNA_MAIZE4.183e-4886.14Proliferating cell nuclear antigen OS=Zea mays GN=... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A07_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181483 ID=CN181483|Name=CN181483|organism=Citrus sinensis|type=EST|length=341bp
GAGGAACGATGCCAACTTTGACTGCTCGGCCACCGGCTTTCTCTCTTCAA
TCCATGGACTCCAGCCACGTGGCGCTGGTGGCCCTGCTGCTCAGATCGGA
AGGCTTCGAGCACTACCGCTGTGACCGGAATATCTCTATGGGAATGAATC
TCAATAACGTGTCCAAGATGCTTAAGTGTGCTGGCAACGATGACATCATC
ACTCTCAAGGCCGACGACGGCAGCGATACCGCTACTCTCATGTTTGAAAG
TCCCACTCAAGATAAGATTGCTGATTTTGAGATGAAACTGATGGACATTG
ATAGAGAGCATCTTGGTATACCGCATGCTGAATACCATGCC
back to top