CN181477

Overview
NameCN181477
Unique NameCN181477
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3890 contig Csv1_Contig3890:239..871. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI_RICCO (Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 9.910e-42
Identity = 80/105 (76.19%), Postives = 93/105 (88.57%), Query Frame = -3
Query:  317 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKDEL 631
            VLLEFYAPWCGHCK+LAPILDEVAVSY++DAD+VIAK DATANDIP DTF+V+GYPTV+FRSASGK   Y+GDRTK+DI+ FIE NRDKAA +E+    +GKDEL
Sbjct:  397 VLLEFYAPWCGHCKQLAPILDEVAVSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGKVEQYDGDRTKDDIISFIEKNRDKAAQQESA---NGKDEL 498          

HSP 2 Score: 67.781 bits (164), Expect = 5.304e-11
Identity = 34/95 (35.79%), Postives = 57/95 (60.00%), Query Frame = -3
Query:  359 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTVFFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAA 631
            +++EFYAPWCGHCKKL P  ++ A +   +D  VV+AK DA   AN      ++++G+PT+      GK++  Y+G R  + I ++++     A+
Sbjct:   52 IVVEFYAPWCGHCKKLRPEYEKAASILKSHDIPVVLAKVDANEEANKELATQYDIKGFPTLKILRNGGKSIQEYKGPREADGIAEYLKKQSGPAS 146          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI_MEDSA (Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 5.090e-38
Identity = 78/115 (67.83%), Postives = 91/115 (79.13%), Query Frame = -3
Query:  317 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA--------PKETVKEES--GKDEL 631
            VL+EFYAPWCGHCK+LAPILDEVAVS+Q+DADVVIAK DATANDIP DTF+VQGYPT++FRSASGK   Y+G RTKEDI++FIE N+DK          PK   + E+   KDEL
Sbjct:  398 VLIEFYAPWCGHCKQLAPILDEVAVSFQSDADVVIAKLDATANDIPTDTFDVQGYPTLYFRSASGKLSQYDGGRTKEDIIEFIEKNKDKTGAAHQEVEQPKAAAQPEAEQPKDEL 512          

HSP 2 Score: 68.1662 bits (165), Expect = 4.061e-11
Identity = 36/96 (37.50%), Postives = 58/96 (60.42%), Query Frame = -3
Query:  359 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDATA---NDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 631
            +++EFYAPWCGHCKKLAP  ++ A +   ++  VV+AK DA      D+  +  +V+G+PT+  FR+       Y+G R  E IV++++     A+
Sbjct:   53 IVVEFYAPWCGHCKKLAPEYEKAASILSTHEPPVVLAKVDANEEHNKDLASEN-DVKGFPTIKIFRNGGKNIQEYKGPREAEGIVEYLKKQSGPAS 147          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI_DATGL (Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 9.598e-37
Identity = 67/103 (65.05%), Postives = 89/103 (86.41%), Query Frame = -3
Query:  323 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKD 631
            VLLEFYAPWCGHCK+LAPILDEVAVS++ND DV+IAK DATAND P +TF+V+GYPT++F+SASG+ + Y+G RTKED ++FIE NR+K++ KE++ ++   D
Sbjct:  398 VLLEFYAPWCGHCKQLAPILDEVAVSFENDPDVLIAKLDATANDYPTNTFDVKGYPTLYFKSASGELLQYDGGRTKEDFIEFIEKNREKSSKKESIVKDDQTD 500          

HSP 2 Score: 75.485 bits (184), Expect = 2.544e-13
Identity = 41/101 (40.59%), Postives = 60/101 (59.41%), Query Frame = -3
Query:  341 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTVFFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAAPKETVK 631
            +++EFYAPWCGHCKKLAP  ++ A +   +D  V++AK DA   AN      FEV+G+PT+      GK V  Y+G R  + IVD+++  +    P   +K
Sbjct:   53 IVVEFYAPWCGHCKKLAPEYEKAASILSSHDPPVILAKVDANEEANKELASEFEVRGFPTIKILRNGGKIVQEYKGPRDADGIVDYLK--KQSGPPSAEIK 151          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI1_ARATH (Probable protein disulfide-isomerase 1 OS=Arabidopsis thaliana GN=At1g21750 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 9.598e-37
Identity = 72/107 (67.29%), Postives = 85/107 (79.44%), Query Frame = -3
Query:  317 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA--PKETVKEESGKDEL 631
            VLLEFYAPWCGHC+KLAPILDEVAVSYQ+D+ VVIAK DATAND P DTF+V+G+PT++F+SASG  V YEGDRTKED + F++ N+D      KE    E  KDEL
Sbjct:  395 VLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVGEPKKEEETTEEVKDEL 501          

HSP 2 Score: 69.707 bits (169), Expect = 1.396e-11
Identity = 38/95 (40.00%), Postives = 55/95 (57.89%), Query Frame = -3
Query:  359 VLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 631
            +++EFYAPWCGHCK+LAP  ++ A +   N   VV+AK DA+   N      +EVQG+PT+  FR+       Y G R  E IV +++     A+
Sbjct:   50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPAS 144          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI2_ARATH (Protein disulfide-isomerase 2 OS=Arabidopsis thaliana GN=At1g77510 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.254e-36
Identity = 73/117 (62.39%), Postives = 90/117 (76.92%), Query Frame = -3
Query:  317 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDK------------AAPKETVKEESGKDEL 631
            VL+EFYAPWCGHC+KLAPILDEVA+S+QND  V+IAK DATANDIP DTF+V+G+PT++FRSASG  V YEGDRTKED ++F+E N +K              PK+T +E + KDEL
Sbjct:  393 VLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSEKKPTSHGEESTKSEEPKKT-EETAAKDEL 508          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI_WHEAT (Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.342e-30
Identity = 61/103 (59.22%), Postives = 78/103 (75.73%), Query Frame = -3
Query:  323 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKD 631
            VL+EFYAPWCGHCKKLAPILDE A + Q++ DVVIAK DATAND+PG+ F+VQGYPT++F + SGK V YEG RT ++IVD+I+ N++ A        E   +
Sbjct:  403 VLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKIDATANDVPGE-FDVQGYPTLYFVTPSGKKVSYEGGRTADEIVDYIKKNKETAGQAAAAATEKAAE 504          

HSP 2 Score: 75.8702 bits (185), Expect = 1.948e-13
Identity = 43/111 (38.74%), Postives = 65/111 (58.56%), Query Frame = -3
Query:  326 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIEN-----NRDKAAPKETVKEESGK 631
            +L+EFYAPWCGHCK LAP  ++ A +  ++D  +V+AK DA    N      +EVQG+PT+  FRS       Y+G R  E IV++++      +++  AP++    E GK
Sbjct:   59 ILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRSGGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYLEDGK 169          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI_MAIZE (Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.991e-30
Identity = 65/116 (56.03%), Postives = 83/116 (71.55%), Query Frame = -3
Query:  317 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAP-----------KETVKEESGKDEL 631
            VL+EFYAPWCGHCKKLAPILDE A + Q+D +VVIAK DATAND+P + F+VQGYPT++F + SGK   Y+  RT +DIVDFI+ +++ AAP           +E  + E  KDEL
Sbjct:  399 VLIEFYAPWCGHCKKLAPILDEAATTLQSDEEVVIAKMDATANDVPSE-FDVQGYPTLYFVTPSGKVTSYDSGRTADDIVDFIKKSKETAAPHHHHHPGATGIREGSRAEPVKDEL 513          

HSP 2 Score: 71.2478 bits (173), Expect = 4.797e-12
Identity = 38/104 (36.54%), Postives = 60/104 (57.69%), Query Frame = -3
Query:  332 VLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEES 631
            +++EFYAPWCGHCKKLAP  +  A +  ++D  +V+AK DA    N      +E+QG+PT+  FR        Y+G R  + IVD+++     A+ +    E++
Sbjct:   54 MVVEFYAPWCGHCKKLAPEYENAAKALSKHDPPIVLAKVDANEEKNRPLATKYEIQGFPTIKIFRDRGKNIQEYKGPREADGIVDYLKKQVGPASKEIKSPEDA 157          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI_HORVU (Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 2.991e-30
Identity = 60/102 (58.82%), Postives = 78/102 (76.47%), Query Frame = -3
Query:  326 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 631
            VL+EFYAPWCGHCKKLAPILDE A + Q++ DVVIAK DAT ND+PG+ F+VQGYPT++F + SGK V YEG RT ++IVD+I  N++ A       E++ +
Sbjct:  402 VLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKMDATENDVPGE-FDVQGYPTLYFVTPSGKKVSYEGGRTADEIVDYIRKNKETAGQAAAATEKAAE 502          

HSP 2 Score: 74.7146 bits (182), Expect = 4.339e-13
Identity = 42/111 (37.84%), Postives = 65/111 (58.56%), Query Frame = -3
Query:  326 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIEN-----NRDKAAPKETVKEESGK 631
            +L+EFYAPWCGHCK LAP  ++ A +  ++D  +V+AK DA    N      +EVQG+PT+  FR+       Y+G R  E IV++++      +++  AP++    E GK
Sbjct:   58 ILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRNGGKSIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYLEDGK 168          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI1_SCHPO (Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe GN=SPAC1F5.02 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 5.653e-21
Identity = 52/101 (51.49%), Postives = 68/101 (67.33%), Query Frame = -3
Query:  335 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAAPKETVKEE 631
            VL+EFYAPWCGHCK LAP  +++A  Y +D++VV+AK DAT NDI   +  + G+PT+ F  A+ K  P  YEGDRT ED+  FI    DK A  E +K+E
Sbjct:  376 VLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVVAKIDATENDI---SVSISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFI----DKHASFEPIKKE 469          
BLAST of CN181477 vs. ExPASy Swiss-Prot
Match: PDI_DROME (Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.383e-21
Identity = 50/111 (45.05%), Postives = 75/111 (67.57%), Query Frame = -3
Query:  317 VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENN---RDKAAPKETVKEESG--KDEL 631
            VL+EFYAPWCGHCK+LAPI D++A  Y+++ D+VIAK D+TAN++  ++ ++  +PT+ +FR    K + +  DRT +D V F++ N    D    +ET +EE    KDEL
Sbjct:  388 VLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANEL--ESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADSEPVEETEEEEEAPKKDEL 496          

HSP 2 Score: 71.633 bits (174), Expect = 3.673e-12
Identity = 38/85 (44.71%), Postives = 52/85 (61.18%), Query Frame = -3
Query:  383 VLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFI 631
            VL+EFYAPWCGHCK LAP   + A    + ++ + +AK DAT      + + V+GYPT+ FFR  SG  V Y G R   DI+ ++
Sbjct:   47 VLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFR--SGSPVEYSGGRQAADIIAWV 129          
The following BLAST results are available for this feature:
BLAST of CN181477 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
PDI_RICCO9.910e-4276.19Protein disulfide-isomerase OS=Ricinus communis PE... [more]
PDI_MEDSA5.090e-3867.83Protein disulfide-isomerase OS=Medicago sativa GN=... [more]
PDI_DATGL9.598e-3765.05Protein disulfide-isomerase OS=Datisca glomerata G... [more]
PDI1_ARATH9.598e-3767.29Probable protein disulfide-isomerase 1 OS=Arabidop... [more]
PDI2_ARATH1.254e-3662.39Protein disulfide-isomerase 2 OS=Arabidopsis thali... [more]
PDI_WHEAT1.342e-3059.22Protein disulfide-isomerase OS=Triticum aestivum G... [more]
PDI_MAIZE2.991e-3056.03Protein disulfide-isomerase OS=Zea mays GN=PDI PE=... [more]
PDI_HORVU2.991e-3058.82Protein disulfide-isomerase OS=Hordeum vulgare GN=... [more]
PDI1_SCHPO5.653e-2151.49Putative protein disulfide-isomerase C1F5.02 OS=Sc... [more]
PDI_DROME7.383e-2145.05Protein disulfide-isomerase OS=Drosophila melanoga... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A04_f Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181477 ID=CN181477|Name=CN181477|organism=Citrus sinensis|type=EST|length=633bp
TATCCATTTCGGATTTAACACGCAGTAAGTTACTCCTAGGCGCCGAAAAT
ACTAAAATATCACAACTATGCGAATACCAAAAAGTACTGCAGCTACAAAT
GCCGAAAATGCCTCCCCATTTTATTCACGGGAACAGAACAGATCTGTAAA
GGGAAATGGCCTAAGAAAAAGCTATAAGGGGGGATATAGGACAAGGGGGA
GGAGAACATCAGGCATTGTTTTGTCGACACTGATAGTTTTGGTATAACAT
CCGCCAAACACGCGCCAACCGACTATGTGCACGGCTCTCTAATAAACTCG
CACCCATTCCTTCTTAGAGCTCATCTTTTCCAGATTCCTCTTTTACAGTT
TCCTTGGGGGCAGCTTTGTCCCTGTTATTTTCAATGAAGTCAACAATATC
TTCTTTGGTCCTATCCCCCTCATAGGGCACTGTCTTTCCACTAGCAGATC
GGAAGAACACGGTTGGGTAACCTTGGACTTCAAAAGTGTCACCAGGAATA
TCATTTGCGGTTGCATCAAATTTTGCAATAACAACATCAGCATCGTTTTG
ATATGAGACAGCAACTTCATCCAAGATTGGAGCCAACTTTTTGCAGTGTC
CACACCAAGGAGCGTAAAACTCGAGCAAAACAT
back to top