CN188332

Overview
NameCN188332
Unique NameCN188332
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length700
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2655 contig Csv1_Contig2655:1..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_HUMAN (Methylthioribose-1-phosphate isomerase OS=Homo sapiens GN=MRI1 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.795e-29
Identity = 82/189 (43.39%), Postives = 112/189 (59.26%), Query Frame = 3
Query:  141 SLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAAT-ASEANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNS--KFSVLTHCNTGSLATAGYGTALGVIRALH 698
            +L++I Y RGSLQ+LDQ  LP ++ Y  +      W AIR M VRG             VE+       G AA  A F+ DKL +LV++RPTAVN++ AA  L ++ ++ A    +   +V +  I   E ML+ D+  N++IG  GA  L  ++  S  K +VLTHCNTG+LATAGYGTALGVIR+LH
Sbjct:    2 TLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGPGLAALVA-FVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLH 189          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_XENTR (Methylthioribose-1-phosphate isomerase OS=Xenopus tropicalis GN=mri1 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.592e-28
Identity = 81/191 (42.41%), Postives = 109/191 (57.07%), Query Frame = 3
Query:  141 SLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLG---DKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATA-SEANSVFQAYIEAAEIMLKDDVATNKAIGSYGAS-FLQNQLKNSKFSVLTHCNTGSLATAGYGTALGVIRALH 698
            SL+S+ Y RGSLQ+L+Q  LP ++ Y  +     G  AIR M VRG             VE+      S T  D  SF+    + L +LV +RPTAVN+  AA +L   ++K A  A +    + ++ I+ AE +LK DV  N+ IG +GA   L+      K  +LTHCNTGSLATAGYGTALGV+R+LH
Sbjct:    2 SLESVRYSRGSLQVLNQLLLPHKSEYEPVTGVQQGADAIRTMKVRGAPAIAIVGVLSLAVELT-----SRTCQDVPSFIAFVQESLCHLVDARPTAVNMKKAADELNAFLAKEAEKAGATTQGLAESVIQWAEALLKKDVEDNQMIGDFGAKHILETAGPTEKVCMLTHCNTGSLATAGYGTALGVVRSLH 187          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_BOVIN (Methylthioribose-1-phosphate isomerase OS=Bos taurus GN=MRI1 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.592e-28
Identity = 81/189 (42.86%), Postives = 110/189 (58.20%), Query Frame = 3
Query:  141 SLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAAT-ASEANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQL--KNSKFSVLTHCNTGSLATAGYGTALGVIRALH 698
            +L++I Y RGSLQ+LDQ  LP ++ Y  +      W AIR M VRG             VE+       G AA  A F+ D L +LV++RPTAVN++ AA  L ++ ++ A    +   +V +  I  AE ML  D+  N++IG  GA  L  +   +  K +VLTHCNTG+LATAGYGTALGVIR+LH
Sbjct:    2 TLEAIRYSRGSLQILDQLLLPQQSRYEAVGSVRQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGPGLAALVA-FVQDALSFLVTARPTAVNMARAARDLADLAAQEAEREGATEEAVRERVICWAEDMLDKDLRDNRSIGDLGAHHLLKRAAPQGGKVTVLTHCNTGALATAGYGTALGVIRSLH 189          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_XENLA (Methylthioribose-1-phosphate isomerase OS=Xenopus laevis GN=mri1 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 6.384e-27
Identity = 75/188 (39.89%), Postives = 107/188 (56.91%), Query Frame = 3
Query:  141 SLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAA-ATASEANSVFQAYIEAAEIMLKDDVATNKAIGSYGAS-FLQNQLKNSKFSVLTHCNTGSLATAGYGTALGVIRALH 698
            SL+S+ Y RGSLQ+L+Q  LP ++ Y  +     G  AIR M VRG             VE+              +F+ + L +LVS+RPTAVN+  AA +L   +++ A    + +  + ++ ++ AE +LK DV  N+ IG +GA   L+      K  +LTHCNTGSLATAGYGTALGV+R+LH
Sbjct:    2 SLESVRYSRGSLQVLNQLLLPHKSEYEPVTGVQQGADAIRTMKVRGAPAIAIVGVLSLAVELTTKPCQD--VPSLITFVRESLHHLVSARPTAVNMKKAADELNAFLAEEADKPGATSQRLTESVVQWAESLLKKDVEDNQMIGDFGAKHILEKAGPTEKVCMLTHCNTGSLATAGYGTALGVVRSLH 187          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_MOUSE (Methylthioribose-1-phosphate isomerase OS=Mus musculus GN=Mri1 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 8.337e-27
Identity = 80/189 (42.33%), Postives = 108/189 (57.14%), Query Frame = 3
Query:  141 SLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAAT-ASEANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQL--KNSKFSVLTHCNTGSLATAGYGTALGVIRALH 698
            +L++I Y  GSLQ+LDQ +LP    Y  +        AIR M VRG             VE+       G AA  A F+ D+L  LV++RPTAVN++ AA  L ++ ++ A    +   +V +  I  AE ML+ D+  N++IG  GA  L  Q   +  K +VLTHCNTG+LATAGYGTALGVIR+LH
Sbjct:    2 TLEAIRYSPGSLQILDQLQLPEHCHYEALSSVQQASEAIRAMKVRGAPAIALVGCLSLAVELRAGAGGPGLAALVA-FVRDQLRLLVAARPTAVNMARAARDLGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLLEQTNPRGGKVTVLTHCNTGALATAGYGTALGVIRSLH 189          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_RAT (Methylthioribose-1-phosphate isomerase OS=Rattus norvegicus GN=Mri1 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.857e-26
Identity = 80/188 (42.55%), Postives = 106/188 (56.38%), Query Frame = 3
Query:  144 LQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAAT-ASEANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQL--KNSKFSVLTHCNTGSLATAGYGTALGVIRALH 698
            L++I Y  GSLQ+LDQ +LP    Y  +        AIR M VRG             VE+       G AA  A F+ D+L  LV++RPTAVN++ AA  L  + ++ A    +   +V +  I  AE ML+ D+  N++IG  GA  L  Q   +  K +VLTHCNTG+LATAGYGTALGVIR+LH
Sbjct:    3 LEAIRYSPGSLQILDQLQLPEHCHYETLSSVQQAREAIRAMKVRGAPAIALVGCLSLAVELQAGAGGPGLAALVA-FVRDQLSLLVAARPTAVNMARAARDLTHMAAREAELEGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLLEQTNPRGGKVTVLTHCNTGALATAGYGTALGVIRSLH 189          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_THISH (Methylthioribose-1-phosphate isomerase OS=Thioalkalivibrio sp. (strain HL-EbGR7) GN=mtnA PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.682e-25
Identity = 79/188 (42.02%), Postives = 108/188 (57.45%), Query Frame = 3
Query:  138 NSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASEANSVFQAYIEA-AEIMLKDDVATNKAIGSYGASFLQNQLKNSKFSVLTHCNTGSLATAGYGTALGVIRALH 698
            ++++++ +   SL+LLDQR+LP ET+YL+I D      AIREMVVRG             +    L A +    DA   L   LE L +SRPTAVNL  A A++K +I +  A          A +EA A  + +DD+A N+ +G  GA+     L +   +VLTHCNTGSLAT GYGTALGVIR+ +
Sbjct:    9 DTVRAVLWDGTSLKLLDQRRLPRETVYLDIPDVGAAADAIREMVVRGAPAIGITAAYGVVLAARRLPADTPDWLDA---LTPDLERLAASRPTAVNLFWALARMKSVIGQVGAD-------LPARLEAEARRIHEDDLADNRRMGELGAA-----LMDPAEAVLTHCNTGSLATGGYGTALGVIRSAY 181          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_SCHPO (Methylthioribose-1-phosphate isomerase OS=Schizosaccharomyces pombe GN=mri1 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.682e-25
Identity = 74/187 (39.57%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  141 SLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASEANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNS-KFSVLTHCNTGSLATAGYGTALGVIRALH 698
            SLQ+I Y    L +LDQ  LP E  Y+ + +  D ++ I++M VRG             V + +L+      ADA  ++ +  E+L  SRPTAVNL + A  ++ I         E  +     I+ AE ML  D+  N  IG+ G  FL    K+  K +VLTHCNTGSLAT+GYGTALG+IR+LH
Sbjct:    2 SLQAIIYNEDKLLVLDQLLLPYERKYISVSNVEDAFAVIKKMQVRGAPAIAIVAALSVAVGLKHLSE----DADAKEYVINSFEHLKQSRPTAVNLFETAKFMQGI------ALQEGKNCRNKIIQEAERMLVKDLEDNHNIGTAGRKFLLQHYKDKDKLTVLTHCNTGSLATSGYGTALGIIRSLH 178          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_YEAST (Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae GN=MRI1 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.282e-23
Identity = 73/210 (34.76%), Postives = 114/210 (54.29%), Query Frame = 3
Query:  108 MALDSVSIDSNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEV--FNLNAFSGTAA--------DAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASEANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNS----KFSVLTHCNTGSLATAGYGTALGVIRAL 695
            M+L+++  D +  +++     S+++LDQ  LP  T Y+ I    DG+S I+ M VRG              EV     N  S  A            + L  +L++L+SSRPTAVNLS++  ++K I+  ++   +   S++    E    ++ +D+A N  +G  GA +L + L+      +F+VLT CNTGSLAT+GYGTALGVIR+L
Sbjct:    1 MSLEAIVFDRSEPENV-----SVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVGSLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIKNILKSSSDLKAFDGSLYNYVCE----LIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTICNTGSLATSGYGTALGVIRSL 201          
BLAST of CN188332 vs. ExPASy Swiss-Prot
Match: MTNA_XYLFA (Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa GN=mtnA PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.775e-22
Identity = 69/173 (39.88%), Postives = 94/173 (54.34%), Query Frame = 3
Query:  174 LQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGXXXXXXXXXXXXXVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASEANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNSKFSVLTHCNTGSLATAGYGTALGVIRA 692
            L+LLDQRKLP    Y+E   S D   AIR ++VRG             +    + A  G   +A   L   L+ L ++RPTAVNL+   A+++  +S A A         QA    AE + ++D+  N+ +G+YGA+ +          VLTHCNTGSLATAG+GTALGVIRA
Sbjct:   25 LKLLDQRKLPFVVEYVECHSSEDVTQAIRALIVRGAPAIGIVAGWGAVLAAREIEAVDGI--EALRKLEPALQRLHAARPTAVNLAWVLARMRRTLSAAHADWR------QAMAREAESIAREDLTANRCMGAYGAALIP-----IGSGVLTHCNTGSLATAGFGTALGVIRA 184          
The following BLAST results are available for this feature:
BLAST of CN188332 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
MTNA_HUMAN1.795e-2943.39Methylthioribose-1-phosphate isomerase OS=Homo sap... [more]
MTNA_XENTR2.592e-2842.41Methylthioribose-1-phosphate isomerase OS=Xenopus ... [more]
MTNA_BOVIN2.592e-2842.86Methylthioribose-1-phosphate isomerase OS=Bos taur... [more]
MTNA_XENLA6.384e-2739.89Methylthioribose-1-phosphate isomerase OS=Xenopus ... [more]
MTNA_MOUSE8.337e-2742.33Methylthioribose-1-phosphate isomerase OS=Mus musc... [more]
MTNA_RAT1.857e-2642.55Methylthioribose-1-phosphate isomerase OS=Rattus n... [more]
MTNA_THISH2.682e-2542.02Methylthioribose-1-phosphate isomerase OS=Thioalka... [more]
MTNA_SCHPO2.682e-2539.57Methylthioribose-1-phosphate isomerase OS=Schizosa... [more]
MTNA_YEAST4.282e-2334.76Methylthioribose-1-phosphate isomerase OS=Saccharo... [more]
MTNA_XYLFA2.775e-2239.88Methylthioribose-1-phosphate isomerase OS=Xylella ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0005N20_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0005N20, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188332 ID=CN188332; Name=CN188332; organism=Citrus sinensis; type=EST; length=700bp
GAGGCATACACTCACTTATATACTGTTTTTTCAGCGAATCATTGGTAATA
TTTGCGTCAGCTTCTGCGAAGCGAGATCGTAAAGTAGCCGCAAGAGAGTG
AAAACAGATGGCTCTTGATTCCGTTTCGATCGACAGCAACTCTCTTCAGT
CCATTTGCTACAGGCGTGGCTCCCTTCAGCTTCTCGACCAGAGAAAGCTT
CCTCTGGAAACTATTTATTTGGAAATTCGCGATTCTGCCGATGGATGGTC
TGCAATACGGGAAATGGTGGTGCGGGGGGCGCCTGCCATTGCTATAGCAG
CGGCACTTTCCCTGGCAGTGGAGGTGTTTAATTTGAATGCATTTAGTGGG
ACTGCTGCCGATGCAGCTTCATTTCTTGGCGATAAGTTGGAATATCTTGT
CTCTAGTCGACCGACTGCAGTGAATCTTTCAGATGCTGCCGCAAAACTCA
AAGAAATCATATCAAAGGCTGCCGCTACTGCTTCAGAAGCCAATAGTGTA
TTTCAGGCCTACATAGAAGCTGCTGAAATTATGCTCAAAGATGATGTTGC
TACAAACAAAGCTATTGGTTCTTATGGGGCAAGTTTTCTTCAGAACCAGC
TCAAAAATTCTAAATTCTCTGTTCTTACTCATTGCAACACTGGCAGTCTT
GCAACAGCTGGATATGGTACCGCCCTTGGTGTGATCCGTGCACTTCATTC
back to top