CK938597

Overview
NameCK938597
Unique NameCK938597
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length875
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10786 contig Csv1_Contig10786:14..888. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK938597 vs. ExPASy Swiss-Prot
Match: NOTUM_MOUSE (Protein notum homolog OS=Mus musculus GN=Notum PE=2 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 1.027e-17
Identity = 56/175 (32.00%), Postives = 91/175 (52.00%), Query Frame = 1
Query:  277 CLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNVTTCLERKKT--RLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLTSILHCDNFRALFP----VGTKVKCFADAGYFINAK 783
            C DGSP  Y+  +  G+    WL+ +EGG +C N   C  R  T  RL SSK        +G+LS++ + NP ++N N + + YC    ++G     +  N   F G+ + Q V+ +L+ KG+  A+  +L+G SAGG   +L+ D    L         +V+  AD+G+F++ K
Sbjct:  108 CNDGSPAGYYLKESKGS--RRWLLFLEGGWYCFNRENCDSRYSTMRRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSG-ASPKSDKNEYAFMGSLIIQEVVRELLGKGLSGAKVLLLAGSSAGGTGVLLNVDRVAELLEELGYPSIQVRGLADSGWFLDNK 279          
BLAST of CK938597 vs. ExPASy Swiss-Prot
Match: NOTUM_HUMAN (Protein notum homolog OS=Homo sapiens GN=NOTUM PE=2 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 2.989e-17
Identity = 55/175 (31.43%), Postives = 93/175 (53.14%), Query Frame = 1
Query:  277 CLDGSPPAYHFDKGFGAGINNWLVHIEGGGWCNNVTTCLERKKT--RLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLTSILHCD----NFRALFPVGTKVKCFADAGYFINAK 783
            C DGSP  Y+  +  G+    WL+ +EGG +C N   C  R  T  RL SS+   +    +G+LS++ + NP ++N N + + YC    ++G   + +  N   F GA + Q V+ +L+ +G+  A+  +L+G SAGG   +L+ D        L     +V+  AD+G+F++ K
Sbjct:  101 CNDGSPAGYYLKESRGS--RRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSG-ASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNK 272          
The following BLAST results are available for this feature:
BLAST of CK938597 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NOTUM_MOUSE1.027e-1732.00Protein notum homolog OS=Mus musculus GN=Notum PE=... [more]
NOTUM_HUMAN2.989e-1731.43Protein notum homolog OS=Homo sapiens GN=NOTUM PE=... [more]
back to top
Libraries
Library NameType
Developing fruit albedo at 165 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004440_F05 Developing fruit albedo at 165 DAFB Citrus sinensis cDNA clone A1650001_IF_F05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK938597 ID=CK938597|Name=CK938597|organism=Citrus sinensis|type=EST|length=875bp
GGAACAAGAAGCTAGCTGCATCCTTTGATCCTTTCTCCTTGAGCTCCCAA
AAAATTGCCATTACTATTTCTTCCCAATGCACTAACCTGGGCTCCTTTTG
CAAACTCTTTAAACTAGTCCCATTTGCAATTGTTTTTTTTGCCTCATTTC
AGAATGGTTGCTGCAAGAATGGGCCAATGGTTGAATCTTTTAGTATGTGC
ACTCATATTACTGAAAGCTGACGGCTTTAATGTAGGAATCACATATGTTG
AGAATGCTGTAGTGAAAGGAGCTGTTTGTTTGGATGGTAGCCCGCCTGCT
TACCATTTTGATAAGGGGTTTGGTGCTGGGATCAATAATTGGTTGGTTCA
CATTGAGGGAGGAGGATGGTGCAACAATGTCACGACTTGTCTTGAACGTA
AGAAAACCCGTTTAGGTTCATCTAAGCAAATGGTCAAGGTAGTTGCATTC
TCCGGGATGCTGAGCAACAAGCAAAAATTTAACCCAGACTTCTACAATTG
GAATAGAATCAAGGTTAGATACTGTGATGGGGCATCGTTTACTGGAGATG
TGGAGGCTGTCAATCCAGCAAATAACCTTCACTTCAGAGGAGCAAGGGTT
TTTCAAGCTGTCATGGAGGATCTAATGGCTAAAGGGATGAAAAATGCTCA
AAATGCTGTTCTTTCTGGCTGCTCAGCTGGGGGATTGACTTCAATTTTGC
ATTGTGATAACTTCCGAGCTCTCTTCCCTGTGGGTACTAAAGTAAAATGC
TTTGCAGATGCTGGTTATTTTATCAACGCGAAGGATGTTTCTGGAGCAAG
TCACATTGAGCAGTTTTATGCTCAAGTGGTCGCAACACATGGATCAGCTA
AGCATTTTGCAGCANCCTGCACTTC
back to top