CK938588

Overview
NameCK938588
Unique NameCK938588
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length857
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2118 contig Csv1_Contig2118:1..857. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK938588 vs. ExPASy Swiss-Prot
Match: GL8D1_XENLA (Glycosyltransferase 8 domain-containing protein 1 OS=Xenopus laevis GN=glt8d1 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.191e-16
Identity = 62/221 (28.05%), Postives = 100/221 (45.25%), Query Frame = 3
Query:  222 NGEPVHIAMTLDPEYLRGTIAAVHSVLKHTSCPENVFFHFIAAESSSANTN---DLAQIVRSAFPYLSFQVYVFREKFVTGLISSSIRRALDSPLNYARIYLADILEPSIKRVIYLDSDVIVVDDIQKLWRIPLSGGRTIGAPEYCHANFTKYSSDEFWSDREFSRVFEGKR-----------PCYFNTGVMVMDLVRWREGDYTRKIEKXXRIQKERRIY 842
            +GE + + +    E L G IA ++S+  +T    NV F+ I    +  + +   D   + R A+  L+F   V   K      +  ++     P+ +AR YL  +L P  K+VIYLD DVIV DDI +L+  P+S G      E C +  +K+      +   +    + K+            C FN GV V +L  WR  + TR++EK   +     +Y
Sbjct:   61 HGEEIAVVIPGVEERLGGLIATINSISSNTK--SNVVFYIITTNDTKKHISSWLDGTDLKRVAYKLLTFDARVLDGKVRVDAGAEPVK-----PMTFARFYLPSLL-PGAKKVIYLDDDVIVQDDIVQLYNTPISPGHAAAFSEDCDSVTSKFPVRGGANQYNYIGFLDYKKERIRSLGIKANTCSFNPGVFVANLTEWRRQNITRQLEKWMELDVTEELY 273          
BLAST of CK938588 vs. ExPASy Swiss-Prot
Match: GL8D1_XENTR (Glycosyltransferase 8 domain-containing protein 1 OS=Xenopus tropicalis GN=glt8d1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.168e-16
Identity = 64/245 (26.12%), Postives = 106/245 (43.27%), Query Frame = 3
Query:  156 ASVQFLEAPVYQNGLECPNLAANGEPVHIAMTLDPEYLRGTIAAVHSVLKHTSCPENVFFHFIAAESSSANTNDLAQIVRS-----AFPYLSFQVYVFREKFVTGLISSSIRRALDSPLNYARIYLADILEPSIKRVIYLDSDVIVVDDIQKLWRIPLSGGRTIGAPEYCHANFTKYSSDEFWSDREFSRVFEGKR-----------PCYFNTGVMVMDLVRWREGDYTRKIEKXXRIQKERRIY 842
            A + F      ++  E P     GE + + +    E L G +AA++S+  +T    NV F+ I        TND    +RS         +++++  F  + + G +          P+ +AR YL ++L P  K+ IYLD DVIV DDI+ L+  PL  G      + C +  +K+      +   +    + K+            C FN GV V +L  WR  + TR++EK   +     +Y
Sbjct:   41 APLVFQRLEALRDAHESPPEERQGEEIAVVIPGVEERLGGLVAAINSISSNTK--SNVVFYIIT-------TNDTKGHIRSWLDGTGLKRVTYKLLAFDTRVLDGKVRVDAGAEPVKPMTFARFYLPNLL-PETKKAIYLDDDVIVQDDIRDLYNTPLRPGHAAAFSDDCDSVTSKFPVRGAANQYNYIGFLDYKKERIRSLGMRANTCSFNPGVFVANLTEWRRQNVTRQLEKWMELDVAEELY 275          
BLAST of CK938588 vs. ExPASy Swiss-Prot
Match: GL8D1_MOUSE (Glycosyltransferase 8 domain-containing protein 1 OS=Mus musculus GN=Glt8d1 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.069e-15
Identity = 59/217 (27.19%), Postives = 97/217 (44.70%), Query Frame = 3
Query:  228 EPVHIAMTLDPEYLRGTIAAVHSVLKHTSCPENVFFHFIAAESSSANTNDLAQIVRSAFPYLSFQVYVFREKFVTGLISSSIRRALD-SPLNYARIYLADILEPSIKRVIYLDSDVIVVDDIQKLWRIPLSGGRTIGAPEYCHANFTK-----------YSSDEFWSDREFSRVFEGKRPCYFNTGVMVMDLVRWREGDYTRKIEKXXRIQKERRIY 842
            E + + +    + L GTIAA++SV  H +   NV F+ +   S++ +    + +   +   + +++  F  K + G +     +     PL +AR YL  IL PS K+ IY+D DVIV  DI  L+  PL  G      E C +  TK           Y     +      ++      C FN GV V +L  W+  + T ++EK  ++  E  +Y
Sbjct:   64 EEIPVVIAASEDRLGGTIAAINSV--HQNTRSNVMFYIVTFNSTADHLR--SWLNSGSLKSIRYKIVNFDTKLLEGKVKQDPDQGESMKPLTFARFYLP-ILVPSAKKAIYMDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSASTKVIIRGAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNVTNQLEKWMKLNVEEGLY 275          
BLAST of CK938588 vs. ExPASy Swiss-Prot
Match: GL8D1_RAT (Glycosyltransferase 8 domain-containing protein 1 OS=Rattus norvegicus GN=Glt8d1 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.861e-15
Identity = 64/242 (26.45%), Postives = 104/242 (42.98%), Query Frame = 3
Query:  153 DASVQFLEAPVYQNGLECPNLAANGEPVHIAMTLDPEYLRGTIAAVHSVLKHTSCPENVFFHFIAAESSSANTNDLAQIVRSAFPYLSFQVYVFREKFVTGLISSSIRRALD-SPLNYARIYLADILEPSIKRVIYLDSDVIVVDDIQKLWRIPLSGGRTIGAPEYCHANFTK-----------YSSDEFWSDREFSRVFEGKRPCYFNTGVMVMDLVRWREGDYTRKIEKXXRIQKERRIY 842
            D +  F + PV +   E P + A  E          + L GTIAA++S+  H +   NV F+ +    ++ +    + +   +   + +++  F  K + G +     +     PL +AR YL  IL PS K+ IY+D DVIV  DI  L+  PL  G      E C +  TK           Y     +      ++      C FN GV V +L  W+  + T ++EK  ++  E  +Y
Sbjct:   49 DFTANFHQHPVNERQEEIPVVIAASE----------DRLGGTIAAINSI--HQNTRSNVIFYIVTFNRTADHLR--SWLNSGSLKSIRYKIVNFDTKLLEGKVKEDPDQGESMKPLTFARFYLP-ILVPSAKKAIYMDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSASTKVMIRGAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNVTNQLEKWMKLNVEEGLY 275          
BLAST of CK938588 vs. ExPASy Swiss-Prot
Match: GL8D1_BOVIN (Glycosyltransferase 8 domain-containing protein 1 OS=Bos taurus GN=GLT8D1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.691e-14
Identity = 58/217 (26.73%), Postives = 99/217 (45.62%), Query Frame = 3
Query:  228 EPVHIAMTLDPEYLRGTIAAVHSVLKHTSCPENVFFHFIAAESSSANTNDLAQIVRSAFPYLSFQVYVFREKFVTGLISSSIRRALD-SPLNYARIYLADILEPSIKRVIYLDSDVIVVDDIQKLWRIPLSGGRTIGAPEYCHANFTKY----SSDEF----WSDREFSRVFE---GKRPCYFNTGVMVMDLVRWREGDYTRKIEKXXRIQKERRIY 842
            E + + +    + L G IAA++S+  +T    NV F+ +    ++ +    + +  S    + +++  F  K + G +     +     PL +AR YL  IL P  K+ IY+D DVIV  DI  L+  PL  G      E C +   K     + +++    + D +  R+ E       C FN GV V +L  WR  + T ++EK  ++  E  +Y
Sbjct:   64 EEIPVVIAASEDRLGGAIAAINSIQHNTR--SNVIFYIVTLNGTADHLR--SWLSSSNLKRIRYKIVNFDTKLLEGKVKEDPDQGESIKPLTFARFYLP-ILVPRAKKAIYMDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSTSAKVVIRGAGNQYNYIGYLDYKKERIRELSMKASTCSFNPGVFVANLTEWRRQNITNQLEKWMKLNVEEGLY 275          
BLAST of CK938588 vs. ExPASy Swiss-Prot
Match: GL8D1_HUMAN (Glycosyltransferase 8 domain-containing protein 1 OS=Homo sapiens GN=GLT8D1 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 3.302e-13
Identity = 55/217 (25.35%), Postives = 95/217 (43.78%), Query Frame = 3
Query:  228 EPVHIAMTLDPEYLRGTIAAVHSVLKHTSCPENVFFHFIAAESSSANTNDLAQIVRSAFPYLSFQVYVFREKFVTGLISSSIRRALD-SPLNYARIYLADILEPSIKRVIYLDSDVIVVDDIQKLWRIPLSGGRTIGAPEYCHANFTK-----------YSSDEFWSDREFSRVFEGKRPCYFNTGVMVMDLVRWREGDYTRKIEKXXRIQKERRIY 842
            E + + +    + L G IAA++S+  +T    NV F+ +   +++ +    + +   +   + +++  F  K + G +     +     PL +AR YL  IL PS K+ IY+D DVIV  DI  L+   L  G      E C +  TK           Y     +      ++      C FN GV V +L  W+  + T ++EK  ++  E  +Y
Sbjct:   64 EEIPVVIAASEDRLGGAIAAINSIQHNTR--SNVIFYIVTLNNTADHLR--SWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLP-ILVPSAKKAIYMDDDVIVQGDILALYNTALKPGHAAAFSEDCDSASTKVVIRGAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNITNQLEKWMKLNVEEGLY 275          
The following BLAST results are available for this feature:
BLAST of CK938588 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
GL8D1_XENLA3.191e-1628.05Glycosyltransferase 8 domain-containing protein 1 ... [more]
GL8D1_XENTR4.168e-1626.12Glycosyltransferase 8 domain-containing protein 1 ... [more]
GL8D1_MOUSE2.069e-1527.19Glycosyltransferase 8 domain-containing protein 1 ... [more]
GL8D1_RAT7.861e-1526.45Glycosyltransferase 8 domain-containing protein 1 ... [more]
GL8D1_BOVIN8.691e-1426.73Glycosyltransferase 8 domain-containing protein 1 ... [more]
GL8D1_HUMAN3.302e-1325.35Glycosyltransferase 8 domain-containing protein 1 ... [more]
back to top
Libraries
Library NameType
Developing fruit albedo at 165 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004440_H12 Developing fruit albedo at 165 DAFB Citrus sinensis cDNA clone A1650001_IF_H12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK938588 ID=CK938588|Name=CK938588|organism=Citrus sinensis|type=EST|length=857bp
GGGGATCAAATGACACAGCAGCGACATCGATCTTTGCTGCGCATTCGATA
ATAATGTTTCGTCCGAGAGAGGTCTTCCCATTAATCTTGTTCGTAAGTTC
CCTCGTGTTCTTGTCCGTGGATGCTGTTAGATCATTTCCGAGGATTAAAT
TCGATGCTTCCGTGCAATTTCTAGAGGCGCCGGTGTATCAAAACGGCCTG
GAGTGTCCGAATTTGGCCGCAAATGGCGAGCCTGTTCACATTGCCATGAC
ACTTGATCCTGAGTACTTGAGGGGCACCATTGCTGCAGTTCACTCGGTTC
TCAAACACACTTCTTGCCCGGAAAACGTTTTCTTTCACTTCATCGCCGCG
GAGTCAAGTTCGGCGAACACAAATGACCTGGCACAGATTGTCCGGTCTGC
CTTCCCTTATTTGAGCTTCCAAGTTTATGTGTTCCGAGAAAAATTCGTCA
CCGGTTTGATCTCGTCTTCTATCCGCCGTGCTCTTGACAGCCCCTTGAAT
TATGCGAGAATTTACTTAGCTGACATACTTGAGCCTTCTATCAAACGCGT
AATCTACCTCGACTCGGATGTCATTGTTGTCGATGATATACAGAAACTCT
GGAGGATTCCCCTATCCGGGGGAAGAACAATCGGAGCTCCAGAGTACTGT
CATGCGAATTTCACCAAGTATTCCTCCGATGAGTTCTGGTCCGACCGCGA
GTTTTCCAGGGTTTTCGAAGGGAAGAGACCTTGCTACTTCAATACAGGAG
TGATGGTCATGGATTTGGTGAGATGGAGGGAGGGTGATTATACGAGGAAG
ATTGAGAAATNNNTGAGGATCCAAAAGGAGAGGAGGATTTATGAGCTGGG
ATCTCTT
back to top