CK938586

Overview
NameCK938586
Unique NameCK938586
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12214 contig Csv1_Contig12214:567..1448. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: AVP1_ARATH (Pyrophosphate-energized vacuolar membrane proton pump 1 OS=Arabidopsis thaliana GN=AVP1 PE=1 SV=1)

HSP 1 Score: 526.939 bits (1356), Expect = 5.993e-150
Identity = 271/282 (96.10%), Postives = 276/282 (97.87%), Query Frame = 1
Query:    4 SFAAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA 849
            SFAAMYG+AVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA I TVDVLTPKV IGL+VGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPG LVMLTPLIVG FFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAG SEHA++LGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA
Sbjct:  479 SFAAMYGVAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAGIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGVSEHAKSLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA 760          

HSP 2 Score: 25.0238 bits (53), Expect = 5.993e-150
Identity = 9/14 (64.29%), Postives = 10/14 (71.43%), Query Frame = 3
Query:  831 FCSLFCTHGGLLFK 872
            F   F THGG+LFK
Sbjct:  755 FAPFFATHGGILFK 768          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: AVP_PHAAU (Pyrophosphate-energized vacuolar membrane proton pump OS=Phaseolus aureus PE=1 SV=3)

HSP 1 Score: 524.242 bits (1349), Expect = 5.993e-150
Identity = 274/282 (97.16%), Postives = 279/282 (98.94%), Query Frame = 1
Query:    4 SFAAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA 849
            +FAAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA+I+TVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPL+VGI FGVETLSGVLAGSLVSGVQIAISASNT GAWDNAKKYIEAGASEHAR+LGPKGSD HKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA
Sbjct:  475 TFAAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRASITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLVVGILFGVETLSGVLAGSLVSGVQIAISASNT-GAWDNAKKYIEAGASEHARSLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA 755          

HSP 2 Score: 27.7202 bits (60), Expect = 5.993e-150
Identity = 11/16 (68.75%), Postives = 12/16 (75.00%), Query Frame = 3
Query:  831 FCSLFCTHGGLLFKIW 878
            F   F THGGLLFKI+
Sbjct:  750 FAPFFATHGGLLFKIF 765          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: AVP_HORVU (Pyrophosphate-energized vacuolar membrane proton pump OS=Hordeum vulgare PE=2 SV=2)

HSP 1 Score: 518.079 bits (1333), Expect = 7.940e-147
Identity = 268/282 (95.04%), Postives = 274/282 (97.16%), Query Frame = 1
Query:    4 SFAAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA 849
            S AAMYGIA+AALGMLST+ATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA +  VDVL+PKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISASNTGGAWDNAKKYIEAG SEHAR+LGPKGSD HKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA
Sbjct:  471 SIAAMYGIAMAALGMLSTMATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAGVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISASNTGGAWDNAKKYIEAGNSEHARSLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA 752          

HSP 2 Score: 23.483 bits (49), Expect = 7.940e-147
Identity = 9/14 (64.29%), Postives = 10/14 (71.43%), Query Frame = 3
Query:  831 FCSLFCTHGGLLFK 872
            F   F T+GGLLFK
Sbjct:  747 FAPFFATYGGLLFK 760          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: HPPA_LEPIN (Pyrophosphate-energized proton pump OS=Leptospira interrogans GN=hppA PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.255e-106
Identity = 195/279 (69.89%), Postives = 231/279 (82.80%), Query Frame = 1
Query:   10 AAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 846
            A MYGIA+AALGM+STIA GL IDAYGP+SDNAGGIAEMA +   +R+RTD LDAAGNTTAAIGKGFAIGSAAL SLALF AF++R   ++++VL  +VF GL+ GAMLP+ F+AMTMKSVG AA+ MVEEVR+QF  IPG+MEG  KPDY  CV IST A+++EMI PG LV+LTP++VG  FGV+TL+GVLAG+LV+GV +AISA+N+GG WDNAKKYIE  A       G KGSD HKAAV+GDT+GDP KDTSGPS+NILIKLMA+ SLVFA FF
Sbjct:  421 AGMYGIAIAALGMISTIAIGLTIDAYGPVSDNAGGIAEMAELGKEVRDRTDTLDAAGNTTAAIGKGFAIGSAALTSLALFAAFITRTHTTSLEVLNAEVFGGLMFGAMLPFLFTAMTMKSVGKAAVDMVEEVRKQFKEIPGIMEGKNKPDYKRCVDISTSAALREMILPGLLVLLTPILVGYLFGVKTLAGVLAGALVAGVVLAISAANSGGGWDNAKKYIEKKA-------GGKGSDQHKAAVVGDTVGDPFKDTSGPSINILIKLMAITSLVFAEFF 692          

HSP 2 Score: 21.9422 bits (45), Expect = 2.255e-106
Identity = 8/17 (47.06%), Postives = 11/17 (64.71%), Query Frame = 3
Query:  831 FCSLFCTHGGLLFKIWN 881
            F   F   GGL+FKI++
Sbjct:  688 FAEFFVQQGGLIFKIFH 704          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: HPPA_LEPIC (Pyrophosphate-energized proton pump OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni GN=hppA PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.255e-106
Identity = 195/279 (69.89%), Postives = 231/279 (82.80%), Query Frame = 1
Query:   10 AAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 846
            A MYGIA+AALGM+STIA GL IDAYGP+SDNAGGIAEMA +   +R+RTD LDAAGNTTAAIGKGFAIGSAAL SLALF AF++R   ++++VL  +VF GL+ GAMLP+ F+AMTMKSVG AA+ MVEEVR+QF  IPG+MEG  KPDY  CV IST A+++EMI PG LV+LTP++VG  FGV+TL+GVLAG+LV+GV +AISA+N+GG WDNAKKYIE  A       G KGSD HKAAV+GDT+GDP KDTSGPS+NILIKLMA+ SLVFA FF
Sbjct:  421 AGMYGIAIAALGMISTIAIGLTIDAYGPVSDNAGGIAEMAELGKEVRDRTDTLDAAGNTTAAIGKGFAIGSAALTSLALFAAFITRTHTTSLEVLNAEVFGGLMFGAMLPFLFTAMTMKSVGKAAVDMVEEVRKQFKEIPGIMEGKNKPDYKRCVDISTSAALREMILPGLLVLLTPILVGYLFGVKTLAGVLAGALVAGVVLAISAANSGGGWDNAKKYIEKKA-------GGKGSDQHKAAVVGDTVGDPFKDTSGPSINILIKLMAITSLVFAEFF 692          

HSP 2 Score: 21.9422 bits (45), Expect = 2.255e-106
Identity = 8/17 (47.06%), Postives = 11/17 (64.71%), Query Frame = 3
Query:  831 FCSLFCTHGGLLFKIWN 881
            F   F   GGL+FKI++
Sbjct:  688 FAEFFVQQGGLIFKIFH 704          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: HPPA_CLOTE (Pyrophosphate-energized proton pump OS=Clostridium tetani GN=hppA PE=3 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.372e-94
Identity = 170/279 (60.93%), Postives = 213/279 (76.34%), Query Frame = 1
Query:    4 SFAAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 840
            +   +YGI++AA+GMLST    +A+DAYGPI+DNAGGIAEM+ + H +RE TD LD+ GNTTAAIGKGFAIGSAAL +L+LF ++     + ++D+L     +GL +GAMLP+ F A+TM+SVG AA +M+EEVRRQF TIPG+MEG A PDY  CV IST A+I+EMI PG L ++ P+ +G+  G E L G+LAG+LVSGV + I  SN GGAWDNAKKYIE GA       G KGS+ HKAAV+GDT+GDP KDTSGPS+NILIKLM + SLVFAP
Sbjct:  387 AMVGLYGISLAAVGMLSTTGLTVAVDAYGPIADNAGGIAEMSELPHEVREITDKLDSVGNTTAAIGKGFAIGSAALTALSLFASYAQATELESIDILNTVTLVGLFIGAMLPFLFGALTMESVGKAANEMIEEVRRQFKTIPGIMEGKATPDYKKCVDISTAAAIREMILPGVLAIVVPVAMGLLLGKEALGGLLAGALVSGVLVGILMSNAGGAWDNAKKYIEGGAH------GGKGSEAHKAAVVGDTVGDPFKDTSGPSMNILIKLMTIVSLVFAP 659          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: HPPA1_METAC (Pyrophosphate-energized proton pump 1 OS=Methanosarcina acetivorans GN=hppA1 PE=3 SV=2)

HSP 1 Score: 343.584 bits (880), Expect = 8.894e-94
Identity = 168/279 (60.22%), Postives = 213/279 (76.34%), Query Frame = 1
Query:   10 AAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 846
            + +YGIA+AA+GML+T+   L++DAYGP++DNAGGIAEM+     +R+ TD LDA GNTTAAIGKGFAIGSAAL +LALF ++     +S +DV+ P VFIGL +GAMLPY FS+MT+ +VG+AA ++V EVRRQF  I GLMEG A PDY  C+ IST +++KEMIPPG L ++ PL+VG+  G   L G+LAGS+ SG  IAI+ SN GGAWDNAKKYIE G        G KGSD HKA V GDT+GDP KDT+GP++NILIKLM++ ++VFAP F
Sbjct:  403 SGLYGIAIAAVGMLATLGISLSVDAYGPVADNAGGIAEMSHQKEEVRQITDTLDAVGNTTAAIGKGFAIGSAALTALALFASYGIAVGLSAIDVMNPNVFIGLTIGAMLPYLFSSMTILAVGNAAGEVVVEVRRQFREIAGLMEGKADPDYGKCIAISTHSALKEMIPPGLLAVIAPLLVGLVLGPGALGGLLAGSVASGFMIAITMSNAGGAWDNAKKYIELG------NFGGKGSDAHKAGVTGDTVGDPFKDTAGPAINILIKLMSIVAVVFAPLF 675          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: HPPA1_METMA (Pyrophosphate-energized proton pump 1 OS=Methanosarcina mazei GN=hppA1 PE=3 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 1.981e-93
Identity = 164/279 (58.78%), Postives = 217/279 (77.78%), Query Frame = 1
Query:   10 AAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 846
            A +YGIA+AA+GML+T+   L++DAYGP++DNAGGIAEM+     +R+ TD LDA GNTTAA+GKGFAIGSAAL +L+LF ++     ++++DV+ P VFIGLI+GAMLP+ FS+MT+ +VG+AA ++V EVRRQF  I GLMEG A PDY+ C+ IST +++KEMIPPG L ++ P++VG+  G   L G+LAGS+VSG  +AI+ SN GG+WDNAKK+IE G        G KGSD HKA V GDT+GDP KDT+GP++NILIKLM++ +LVFAP F
Sbjct:  403 AGLYGIAIAAVGMLATLGISLSVDAYGPVADNAGGIAEMSHQKKEVRQITDTLDAVGNTTAAMGKGFAIGSAALTALSLFASYAIAVGLTSIDVMNPNVFIGLIIGAMLPFLFSSMTILAVGNAAGEVVVEVRRQFKEIKGLMEGKADPDYSKCITISTHSALKEMIPPGILAVIAPILVGLVLGAGALGGLLAGSVVSGFMLAITMSNAGGSWDNAKKFIELG------NFGGKGSDAHKAGVTGDTVGDPFKDTAGPAINILIKLMSIVALVFAPLF 675          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: HPPA_FUSNN (Pyrophosphate-energized proton pump OS=Fusobacterium nucleatum subsp. nucleatum GN=hppA PE=3 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.986e-85
Identity = 161/282 (57.09%), Postives = 208/282 (73.76%), Query Frame = 1
Query:   16 MYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAIST-----VDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 846
            +YGI++AA+GML+T    +A+DAYGP++DNAGGIAEM+ +   +RE TD LDA GN+TAA+GKGFAIGSAAL +L+LF A+       T     +DV  P+V  GL +G ML + FSA+TM +VG AA++MVEEVRRQF   PG+M+ T KPDY  CV+IST +S+K+MI PG L ++ P+I+G+ + V+ L G+LAG+LV+GV +AI  +N GGAWDN KK IE G          KGSD HKAAV+GDT+GDP KDTSGPSLNILIKLM++ SLV  P F
Sbjct:  392 LYGISIAAVGMLATTGMVVAVDAYGPVADNAGGIAEMSELPPEVRETTDKLDAVGNSTAAVGKGFAIGSAALTALSLFAAYKEAVDKLTSEALVIDVTDPEVIAGLFIGGMLTFLFSALTMTAVGKAAIEMVEEVRRQFREFPGIMDRTQKPDYKRCVEISTHSSLKQMILPGVLAIIVPVIIGL-WSVKALGGLLAGALVTGVLMAIMMANAGGAWDNGKKQIEGGYKG-----DKKGSDRHKAAVVGDTVGDPFKDTSGPSLNILIKLMSIVSLVLVPLF 667          
BLAST of CK938586 vs. ExPASy Swiss-Prot
Match: HPPA_THEMA (Pyrophosphate-energized proton pump OS=Thermotoga maritima GN=hppA PE=1 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.473e-80
Identity = 149/293 (50.85%), Postives = 208/293 (70.99%), Query Frame = 1
Query:    7 FAAMYGIAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSR-----------AAISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFAH 852
            FA +YG+A+AALGMLS +AT +++D+YGPI+DNAGGI+EM  +   +R+ TD LDA GNTTAAIGKGFAIGSA   +L+LF +++             + +  +++L  +V  G ++GA + Y+FS   + +V  AA+KMV+E+RRQ   IPGL+EG AKPDY  C++I++D ++K+M  P  + +LTPL+ G   G E + GVL G+++SG  +AI  +N+GGAWDNAKKY+EAG  E       KGS+PHKA VIGDT+GDPLKDT GPSL+ILIK+M+V S++    F H
Sbjct:  434 FAGLYGVAIAALGMLSFVATSVSVDSYGPIADNAGGISEMCELDPEVRKITDHLDAVGNTTAAIGKGFAIGSAIFAALSLFASYMFSQISPSDIGKPPSLVLLLNMLDARVIAGALLGAAITYYFSGYLISAVTKAAMKMVDEIRRQAREIPGLLEGKAKPDYNRCIEITSDNALKQMGYPAFIAILTPLVTGFLLGAEFVGGVLIGTVLSGAMLAILTANSGGAWDNAKKYLEAGNLEGY----GKGSEPHKALVIGDTVGDPLKDTVGPSLDILIKIMSVVSVIAVSIFKH 722          
The following BLAST results are available for this feature:
BLAST of CK938586 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
AVP1_ARATH5.993e-15096.10Pyrophosphate-energized vacuolar membrane proton p... [more]
AVP_PHAAU5.993e-15097.16Pyrophosphate-energized vacuolar membrane proton p... [more]
AVP_HORVU7.940e-14795.04Pyrophosphate-energized vacuolar membrane proton p... [more]
HPPA_LEPIN2.255e-10669.89Pyrophosphate-energized proton pump OS=Leptospira ... [more]
HPPA_LEPIC2.255e-10669.89Pyrophosphate-energized proton pump OS=Leptospira ... [more]
HPPA_CLOTE1.372e-9460.93Pyrophosphate-energized proton pump OS=Clostridium... [more]
HPPA1_METAC8.894e-9460.22Pyrophosphate-energized proton pump 1 OS=Methanosa... [more]
HPPA1_METMA1.981e-9358.78Pyrophosphate-energized proton pump 1 OS=Methanosa... [more]
HPPA_FUSNN1.986e-8557.09Pyrophosphate-energized proton pump OS=Fusobacteri... [more]
HPPA_THEMA1.473e-8050.85Pyrophosphate-energized proton pump OS=Thermotoga ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit albedo at 165 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004440_H10 Developing fruit albedo at 165 DAFB Citrus sinensis cDNA clone A1650001_IF_H10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK938586 ID=CK938586|Name=CK938586|organism=Citrus sinensis|type=EST|length=881bp
GGGAGTTTTGCTGCCATGTATGGTATTGCAGTTGCCGCCCTTGGAATGCT
AAGCACCATAGCTACTGGATTGGCTATTGATGCATATGGTCCCATCAGTG
ACAATGCTGGAGGCATTGCTGAGATGGCAGGCATGAGCCACAGAATCAGA
GAGAGAACTGATGCTCTTGATGCTGCAGGAAACACCACCGCAGCTATTGG
AAAGGGTTTCGCCATTGGTTCTGCAGCTCTTGTGTCGCTAGCCCTCTTTG
GTGCCTTTGTGAGCCGTGCAGCTATTTCAACTGTTGATGTGTTGACTCCA
AAAGTGTTTATTGGTTTGATTGTTGGTGCTATGCTTCCTTACTGGTTCTC
TGCCATGACAATGAAGAGTGTGGGAAGTGCAGCTCTTAAAATGGTTGAGG
AAGTGCGCAGGCAATTTAACACCATCCCTGGTCTTATGGAAGGCACTGCC
AAACCTGATTATGCTACCTGTGTTAAGATCTCCACCGATGCATCCATCAA
AGAGATGATCCCACCTGGTGCCCTTGTCATGCTTACACCCCTTATTGTTG
GTATCTTTTTTGGCGTGGAAACTCTCTCTGGGGTCCTTGCCGGTTCCCTT
GTCTCAGGTGTACAGATTGCTATCTCTGCATCCAACACTGGTGGTGCCTG
GGATAACGCCAAGAAGTACATTGAGGCTGGCGCTTCAGAGCACGCCAGAA
CTCTTGGTCCAAAAGGATCAGATCCACACAAGGCTGCGGTCATTGGTGAC
ACAATTGGGGATCCATTGAAGGACACATCTGGACCATCACTTAACATCCT
AATCAAGCTAATGGCAGTGGAATCACTTGTTTTTGCTCCCTTTTTTGCAC
ACACGGTGGCTTGCTTTTCAAGATATGGAAT
back to top