CK937441

Overview
NameCK937441
Unique NameCK937441
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length675
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10885 contig Csv1_Contig10885:11..684. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: SFGH_ARATH (S-formylglutathione hydrolase OS=Arabidopsis thaliana GN=SFGH PE=1 SV=2)

HSP 1 Score: 343.969 bits (881), Expect = 4.325e-94
Identity = 162/195 (83.08%), Postives = 174/195 (89.23%), Query Frame = 2
Query:   89 TEISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKWKNWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNKA 673
            +EI S+KMF GYNKR+KHFS TLGCSM F IYF       +K PVLYWLSGLTCTDENFI KSGAQRAAS  G+AL+APDTSPRGLNVEGEADS+DFGVGAGFYLNATQEKWKNWRMYDYVVKELPKLLSENF QL+T++ASI GHSMGGHGALTIYL+NLDKYKSVSAFAPI NP+NC WGQKAFTNYLG NKA
Sbjct:    6 SEIGSTKMFDGYNKRYKHFSETLGCSMTFSIYFPPSASSSHKSPVLYWLSGLTCTDENFIIKSGAQRAASTHGIALVAPDTSPRGLNVEGEADSYDFGVGAGFYLNATQEKWKNWRMYDYVVKELPKLLSENFSQLDTTKASISGHSMGGHGALTIYLRNLDKYKSVSAFAPITNPINCAWGQKAFTNYLGDNKA 200          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: ESTD_BOVIN (S-formylglutathione hydrolase OS=Bos taurus GN=ESD PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.237e-66
Identity = 120/195 (61.54%), Postives = 150/195 (76.92%), Query Frame = 2
Query:   92 EISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKWK-NWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNKA 673
            ++SSSK FGG  K F+H S  L C M F +Y         K PVLYWLSGLTCT++NFI+KSG  +AAS  G+ +IAPDTSPRG N++GE DSWDFG GAGFY++AT++ WK N+RMY YV KELP+L+++NFP ++  R S+FGHSMGGHGAL   LKN  KYKSVSAFAP+CNPV C WG+KAFT YLG++++
Sbjct:    5 QVSSSKCFGGLQKVFEHDSVELKCKMKFAVYLPPKAETG-KCPVLYWLSGLTCTEQNFISKSGYHQAASEHGLVVIAPDTSPRGCNIKGEEDSWDFGTGAGFYVDATEDLWKTNYRMYSYVTKELPQLVNDNFP-VDPQRMSVFGHSMGGHGALICALKNPGKYKSVSAFAPLCNPVLCRWGKKAFTGYLGTDQS 197          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: ESTD_RAT (S-formylglutathione hydrolase OS=Rattus norvegicus GN=Esd PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 6.508e-66
Identity = 123/201 (61.19%), Postives = 150/201 (74.63%), Query Frame = 2
Query:   74 METKPTEISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKWK-NWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNKA 673
            ME K  +ISS+K FGG  K F+H S  L C M F IY         K P LYWLSGLTCT++NFI+KSG Q+AAS  G+ +IAPDTSPRG N++GE DSWDFG GAGF++NAT++ W  N+RMY YV +ELP+L++ NFP ++  R SIFGHSMGGHGAL   LKN  KY+SVSAFAPICNPV CPWG+KAF  YLG +++
Sbjct:    1 MELK--QISSNKCFGGLQKVFEHSSVELKCKMKFAIYLPPQAESA-KCPALYWLSGLTCTEQNFISKSGCQQAASEHGLVVIAPDTSPRGCNIKGEDDSWDFGTGAGFFVNATEDPWNTNYRMYSYVTEELPQLINANFP-VDPQRISIFGHSMGGHGALICALKNPGKYRSVSAFAPICNPVLCPWGKKAFNGYLGPDQS 197          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: ESTD_PIG (S-formylglutathione hydrolase OS=Sus scrofa GN=ESD PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.450e-65
Identity = 120/195 (61.54%), Postives = 148/195 (75.90%), Query Frame = 2
Query:   92 EISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKWK-NWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNKA 673
            ++SS+K FGG  K F+H S  L C M F IY         K P LYWLSGLTCT++NFI KSG  +AAS  G+ +IAPDTSPRG N++GE +SWDFG GAGFYL+AT++ WK N+RMY YV +ELP+L++ NFP ++  R SIFGHSMGGHGAL   LKN  KYKSVSAFAPICNPV CPWG+KAF+ YLG++++
Sbjct:    5 QLSSNKCFGGLQKVFEHDSVELKCKMKFAIYLPPKAETG-KCPALYWLSGLTCTEQNFITKSGYHQAASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYLDATEDPWKTNYRMYSYVTEELPQLINANFP-VDPQRMSIFGHSMGGHGALICTLKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDES 197          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: ESTD_MOUSE (S-formylglutathione hydrolase OS=Mus musculus GN=Esd PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.473e-65
Identity = 119/195 (61.03%), Postives = 148/195 (75.90%), Query Frame = 2
Query:   92 EISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKWK-NWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNKA 673
            +ISS++ FGG  K F+H S  L C M F +Y         K P LYWLSGLTCT++NFI+KSG Q+AAS  G+ +IAPDTSPRG N++GE DSWDFG GAGFY+NAT++ WK N+RMY YV +ELP+L++ NFP ++  R SIFGHSMGGHGAL   LKN  KY+SVSAFAPICNPV C WG+KAF+ YLG +++
Sbjct:    5 QISSNRCFGGLQKVFEHSSVELKCKMRFAVYLPPQAESG-KCPALYWLSGLTCTEQNFISKSGYQQAASEHGLVVIAPDTSPRGCNIKGEDDSWDFGTGAGFYVNATEDPWKANYRMYSYVTEELPQLINANFP-VDPQRMSIFGHSMGGHGALICALKNPGKYRSVSAFAPICNPVLCSWGKKAFSGYLGPDES 197          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: ESTD_HUMAN (S-formylglutathione hydrolase OS=Homo sapiens GN=ESD PE=1 SV=2)

HSP 1 Score: 248.44 bits (633), Expect = 2.473e-65
Identity = 118/195 (60.51%), Postives = 149/195 (76.41%), Query Frame = 2
Query:   92 EISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKWK-NWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNKA 673
            +ISS+K FGG  K F+H S  L C M F +Y         K P LYWLSGLTCT++NFI+KSG  ++AS  G+ +IAPDTSPRG N++GE +SWDFG GAGFY++AT++ WK N+RMY YV +ELP+L++ NFP ++  R SIFGHSMGGHGAL   LKN  KYKSVSAFAPICNPV CPWG+KAF+ YLG++++
Sbjct:    5 QISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETG-KCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFP-VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 197          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: SFGH1_ECOHS (S-formylglutathione hydrolase frmB OS=Escherichia coli O9:H4 (strain HS) GN=frmB PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.348e-52
Identity = 102/193 (52.85%), Postives = 132/193 (68.39%), Query Frame = 2
Query:   95 ISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKW-KNWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNK 670
            I     FGG+   ++H+S +L C MN  +Y         K PVLYWLSGLTC ++NFI KSG QR A+   + ++APDTSPRG +V  +AD +D G GAGFYLNATQ  W ++++MYDY+  ELP L+ ++FP   T+R SI GHSMGG GAL + L+N D+Y SVSAF+PI +P   PWGQ+AF  YLG NK
Sbjct:    4 IEKHASFGGWQNVYRHYSQSLKCEMNVGVYLPPKAANE-KLPVLYWLSGLTCNEQNFITKSGMQRYAAEHNIIVVAPDTSPRGSHV-ADADRYDLGQGAGFYLNATQAPWNEHYKMYDYIRNELPDLVMQHFPA--TTRKSISGHSMGGLGALVLALRNPDEYVSVSAFSPIVSPSQAPWGQQAFAAYLGENK 192          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: SFGH1_SHISS (S-formylglutathione hydrolase frmB OS=Shigella sonnei (strain Ss046) GN=frmB PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.985e-52
Identity = 102/193 (52.85%), Postives = 132/193 (68.39%), Query Frame = 2
Query:   95 ISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKW-KNWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNK 670
            I     FGG+   ++H+S +L C MN  +Y         K PVLYWLSGLTC ++NFI KSG QR A+   + ++APDTSPRG +V  +AD +D G GAGFYLNATQ  W ++++MYDY+  ELP L+ ++FP   T+R SI GHSMGG GAL + L+N D+Y SVSAF+PI +P   PWGQ+AF  YLG NK
Sbjct:    4 IEKHASFGGWQNVYRHYSQSLKCEMNVGVYLPPKAANE-KLPVLYWLSGLTCNEQNFITKSGMQRYAAEHNIIVVAPDTSPRGSHV-ADADRYDLGQGAGFYLNATQAPWNEHYKMYDYIRNELPDLVMQHFPA--TTRKSISGHSMGGLGALVLALRNPDEYVSVSAFSPIVSPSQVPWGQQAFAAYLGENK 192          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: SFGH1_ECOSM (S-formylglutathione hydrolase frmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=frmB PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.985e-52
Identity = 102/193 (52.85%), Postives = 132/193 (68.39%), Query Frame = 2
Query:   95 ISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKW-KNWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNK 670
            I     FGG+   ++H+S +L C MN  +Y         K PVLYWLSGLTC ++NFI KSG QR A+   + ++APDTSPRG +V  +AD +D G GAGFYLNATQ  W ++++MYDY+  ELP L+ ++FP   T+R SI GHSMGG GAL + L+N D+Y SVSAF+PI +P   PWGQ+AF  YLG NK
Sbjct:    4 IEKHASFGGWQNVYRHYSQSLKCEMNVGVYLPPKAGNE-KLPVLYWLSGLTCNEQNFITKSGMQRYAAEHNIIVVAPDTSPRGSHV-ADADRYDLGQGAGFYLNATQAPWNEHYKMYDYIHNELPDLVMQHFPA--TTRKSISGHSMGGLGALVLALRNPDEYVSVSAFSPIVSPSQVPWGQQAFAAYLGENK 192          
BLAST of CK937441 vs. ExPASy Swiss-Prot
Match: SFGH1_ECOL6 (S-formylglutathione hydrolase frmB OS=Escherichia coli O6 GN=frmB PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.985e-52
Identity = 102/193 (52.85%), Postives = 131/193 (67.88%), Query Frame = 2
Query:   95 ISSSKMFGGYNKRFKHFSTTLGCSMNFHIYFXXXXXXXYKFPVLYWLSGLTCTDENFIAKSGAQRAASAEGVALIAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKW-KNWRMYDYVVKELPKLLSENFPQLETSRASIFGHSMGGHGALTIYLKNLDKYKSVSAFAPICNPVNCPWGQKAFTNYLGSNK 670
            I     FGG+   ++H+S +L C MN  +Y         K PVLYWLSGLTC ++NFI KSG QR A+   + ++APDTSPRG +V  +AD +D G GAGFYLNATQ  W ++++MYDY+  ELP L+  +FP   T+R SI GHSMGG GAL + L+N D+Y SVSAF+PI +P   PWGQ+AF  YLG NK
Sbjct:    4 IEKHASFGGWQNVYRHYSQSLKCEMNVGVYLPPKAENE-KLPVLYWLSGLTCNEQNFITKSGMQRYAAEHNIIVVAPDTSPRGSHV-ADADRYDLGQGAGFYLNATQAPWNEHYKMYDYIRNELPNLVMHHFPA--TARKSISGHSMGGLGALVLALRNPDEYASVSAFSPIVSPSQVPWGQQAFAAYLGENK 192          
The following BLAST results are available for this feature:
BLAST of CK937441 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
SFGH_ARATH4.325e-9483.08S-formylglutathione hydrolase OS=Arabidopsis thali... [more]
ESTD_BOVIN2.237e-6661.54S-formylglutathione hydrolase OS=Bos taurus GN=ESD... [more]
ESTD_RAT6.508e-6661.19S-formylglutathione hydrolase OS=Rattus norvegicus... [more]
ESTD_PIG1.450e-6561.54S-formylglutathione hydrolase OS=Sus scrofa GN=ESD... [more]
ESTD_MOUSE2.473e-6561.03S-formylglutathione hydrolase OS=Mus musculus GN=E... [more]
ESTD_HUMAN2.473e-6560.51S-formylglutathione hydrolase OS=Homo sapiens GN=E... [more]
SFGH1_ECOHS5.348e-5252.85S-formylglutathione hydrolase frmB OS=Escherichia ... [more]
SFGH1_SHISS6.985e-5252.85S-formylglutathione hydrolase frmB OS=Shigella son... [more]
SFGH1_ECOSM6.985e-5252.85S-formylglutathione hydrolase frmB OS=Escherichia ... [more]
SFGH1_ECOL66.985e-5252.85S-formylglutathione hydrolase frmB OS=Escherichia ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in pTriplEx2 vectorcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004780_G04 Developing fruit albedo at 80 DAFB in pTriplEx2 vector Citrus sinensis cDNA clone A80DAB0003_IVF_G04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK937441 ID=CK937441|Name=CK937441|organism=Citrus sinensis|type=EST|length=675bp
CGCGCCGGGNNNTGAAAGAACAAAGATCGTACACACACAGGGGCGAGCNN
NACACAATCAATCACAGAGAAAAATGGAGACGAAGCCGACAGAGATAAGC
AGTTCTAAGATGTTCGGTGGATACAACAAAAGATTCAAGCATTTCAGTAC
AACACTGGGCTGCTCCATGAATTTCCACATCTACTTCCCTCCTTCTTCTT
CTCCATCCTACAAATTCCCTGTGCTTTACTGGCTCTCTGGTCTTACCTGC
ACTGATGAAAATTTTATAGCTAAGTCAGGAGCTCAACGTGCTGCTTCCGC
TGAAGGTGTGGCTCTGATTGCCCCTGATACATCTCCAAGAGGCCTGAATG
TGGAAGGAGAGGCAGATAGCTGGGATTTTGGTGTAGGTGCTGGATTTTAT
CTTAATGCTACACAGGAGAAGTGGAAGAACTGGCGTATGTATGACTATGT
TGTCAAGGAATTGCCCAAACTTCTGAGTGAAAATTTTCCACAGCTTGAAA
CTTCTCGAGCATCCATATTTGGTCACTCAATGGGTGGGCATGGTGCTTTG
ACAATCTATCTGAAAAATCTTGACAAGTATAAGTCTGTATCTGCCTTTGC
TCCAATTTGCAATCCTGTCAACTGTCCCTGGGGTCAGAAGGCTTTTACAA
ATTATCTTGGTAGTAACAAAGCTGA
back to top