FC921758

Overview
NameFC921758
Unique NameFC921758
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length327
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1373 contig Csv1_Contig1373:268..594. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC921758 vs. ExPASy Swiss-Prot
Match: PP11_HUMAN (Placental protein 11 OS=Homo sapiens PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.191e-13
Identity = 36/97 (37.11%), Postives = 59/97 (60.82%), Query Frame = -2
Query:    3 DMAQGSLFSWLSDDVFRKPTYSRFCSLLDNYNPNAGHKEVVTSEEKQEQAAFIEEISRTAPIKYLHKYLSAKGMVSGNYQDFKRTISSLWFDLYGGG 293
            D     LF+++++ +F KPTY+ F +LL+NY    GH E  +++E  EQ AF+ EI +TA +K L+ +L  +    G+ Q+F   + ++WF LY  G
Sbjct:  138 DRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRY-GSEQEFVDDLKNMWFGLYSRG 233          
BLAST of FC921758 vs. ExPASy Swiss-Prot
Match: ENDUB_XENLA (Poly(U)-specific endoribonuclease-B OS=Xenopus laevis GN=endou-B PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.845e-12
Identity = 38/101 (37.62%), Postives = 54/101 (53.47%), Query Frame = -2
Query:   12 KAYQKDDMAQGSLFSWLSDDVFR-KPTYSRFCSLLDNYNPNAGHKEVVTSEEKQEQAAFIEEISRTAPIKYLHKYLSAKGMVSGNYQDFKRTISSLWFDLY 311
            ++ Q  D A   LF ++ ++  + K T++ F SLLDNY  + G  EVVT EE  E   F++ I  T  +K  H YL  K     +  DFK  + S+WF LY
Sbjct:   47 RSNQAKDSASYPLFQFVDEEKLKSKKTFATFISLLDNYEMDTGVAEVVTPEEIAENNNFLDAILETKVMKMAHDYLVRKNQAKPSQNDFKVQLYSIWFQLY 147          
BLAST of FC921758 vs. ExPASy Swiss-Prot
Match: ENDOU_XENTR (Poly(U)-specific endoribonuclease OS=Xenopus tropicalis GN=endou PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.168e-11
Identity = 37/98 (37.76%), Postives = 52/98 (53.06%), Query Frame = -2
Query:   12 QKDDMAQGSLFSWLSDDVFR-KPTYSRFCSLLDNYNPNAGHKEVVTSEEKQEQAAFIEEISRTAPIKYLHKYLSAKGMVSGNYQDFKRTISSLWFDLY 302
            Q  D A   LF ++ ++  R + T++ F SLLDNY  + G  EVVT EE  E   F++ I  T  +K  H YL  K     +  DFK  + ++WF LY
Sbjct:   51 QARDSASYPLFQFVDEEKLRSRKTFATFISLLDNYEMDTGVAEVVTPEEIAENNTFLDAILETKVMKIAHDYLVRKNQAKPSRNDFKAQLYTIWFQLY 148          
BLAST of FC921758 vs. ExPASy Swiss-Prot
Match: ENDUA_XENLA (Poly(U)-specific endoribonuclease-A OS=Xenopus laevis GN=endou-A PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.884e-11
Identity = 36/98 (36.73%), Postives = 51/98 (52.04%), Query Frame = -2
Query:   12 QKDDMAQGSLFSWLSDDVFR-KPTYSRFCSLLDNYNPNAGHKEVVTSEEKQEQAAFIEEISRTAPIKYLHKYLSAKGMVSGNYQDFKRTISSLWFDLY 302
            Q  D A   LF ++ ++  + + T++ F SLLDNY  + G  EVVT EE  E   F++ I  T  +K  H YL  K        DFK  + ++WF LY
Sbjct:   50 QARDSASFPLFQFVDEEKLKSRKTFATFISLLDNYEMDTGVAEVVTPEEIAENNNFLDAILETKVMKMAHDYLVRKNQAKPTRNDFKVQLYNIWFQLY 147          
The following BLAST results are available for this feature:
BLAST of FC921758 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
PP11_HUMAN6.191e-1337.11Placental protein 11 OS=Homo sapiens PE=1 SV=1[more]
ENDUB_XENLA6.845e-1237.62Poly(U)-specific endoribonuclease-B OS=Xenopus lae... [more]
ENDOU_XENTR1.168e-1137.76Poly(U)-specific endoribonuclease OS=Xenopus tropi... [more]
ENDUA_XENLA9.884e-1136.73Poly(U)-specific endoribonuclease-A OS=Xenopus lae... [more]
back to top
Libraries
Library NameType
RindPdigScdna_library
Properties
Property NameValue
Genbank descriptionC06052A05T7 RindPdigS Citrus sinensis cDNA clone C06052A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC921758 ID=FC921758|Name=FC921758|organism=Citrus sinensis|type=EST|length=327bp
CCACCTCCGCCATAAAGATCAAACCAGAGACTGCTGATTGTTCTTTTAAA
ATCTTGATAATTCCCAGATACCATGCCCTTGGCTGAGAGATACTTATGAA
GATATTTAATTGGCGCAGTTCTACTGATTTCTTCAATGAAAGCAGCTTGC
TCCTGCTTCTCTTCAGATGTGACAACTTCTTTGTGTCCTGCATTTGGATT
GTAATTATCTAAAAGCGAACAAAACCGAGAATAAGTAGGCTTCCTGAATA
CGTCATCACTAAGCCAACTGAACAGGCTTCCTTGTGCCATATCATCCTTT
TGGTAAGCCTTCTTCCCGTCACCCCGC
back to top