FC921755

Overview
NameFC921755
Unique NameFC921755
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length299
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1554 contig Csv1_Contig1554:1119..1416. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC921755 vs. ExPASy Swiss-Prot
Match: DHBK_SOLLC (Putative 3,4-dihydroxy-2-butanone kinase OS=Solanum lycopersicum GN=DHBK PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 6.616e-35
Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 3
Query:    6 PGQVTSDPLGPGKMELGLRIPGEPGAAVADLPPVDLVVSHVLKPILSTETNYVPITRGNRVV 191
            PGQVTSD LGPGKMELGL I GEPGAAVADL PVD+VVSHVLK ILS ETNYVPITRG+RVV
Sbjct:  206 PGQVTSDRLGPGKMELGLGIHGEPGAAVADLQPVDVVVSHVLKEILSPETNYVPITRGSRVV 267          

HSP 2 Score: 61.6178 bits (148), Expect = 6.616e-35
Identity = 30/35 (85.71%), Postives = 32/35 (91.43%), Query Frame = 1
Query:  193 LLINGLGAPPVMELMIAAGKAVPNLQLEHGLAVER 297
            LLINGLGA P+MELMI AGKAVP LQLEHGLAV+R
Sbjct:  268 LLINGLGATPLMELMIIAGKAVPELQLEHGLAVDR 302          
The following BLAST results are available for this feature:
BLAST of FC921755 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
DHBK_SOLLC6.616e-3587.10Putative 3,4-dihydroxy-2-butanone kinase OS=Solanu... [more]
back to top
Libraries
Library NameType
RindPdigScdna_library
Properties
Property NameValue
Genbank descriptionC06052A01T7 RindPdigS Citrus sinensis cDNA clone C06052A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC921755 ID=FC921755|Name=FC921755|organism=Citrus sinensis|type=EST|length=299bp
CCCTGCCTGGGCAGGTTACCTCCGATCCTTTGGGCCCTGGAAAGATGGAA
CTTGGTCTCCGAATTCCTGGTGAACCTGGTGCTGCCGTGGCTGATCTTCC
GCCCGTAGACCTGGTTGTATCTCACGTTCTTAAGCCAATATTGTCCACGG
AAACCAATTATGTTCCCATAACCCGAGGTAATAGAGTGGTGCCTCCTGAT
TAATGGCTTAGGTGCCCCTCCTGTGATGGAACTGATGATTGCAGCAGGAA
AAGCAGTCCCAAATTTGCAACTGGAACATGGACTGGCTGTTGAAAGAGT
back to top