CN186552
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN186552 vs. ExPASy Swiss-Prot
Match: CDPK8_ARATH (Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1) HSP 1 Score: 99.3673 bits (246), Expect = 1.805e-20 Identity = 49/56 (87.50%), Postives = 50/56 (89.29%), Query Frame = -2 Query: 351 AIMHDVDTDKDGRISYEEFAVMMKAGPDWRKASRQYSPERFNSISLKLMREEGLQL 518 AIM DVDTDKDGRISYEEFA MMKAG DWRKASRQYS ERFNS+SLKLMRE LQL Sbjct: 474 AIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGSLQL 529
BLAST of CN186552 vs. ExPASy Swiss-Prot
Match: CDPK7_ARATH (Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=1 SV=1) HSP 1 Score: 96.6709 bits (239), Expect = 1.170e-19 Identity = 47/56 (83.93%), Postives = 49/56 (87.50%), Query Frame = -2 Query: 351 AIMHDVDTDKDGRISYEEFAVMMKAGPDWRKASRQYSPERFNSISLKLMREEGLQL 518 AIM DVDTDKDGRISYEEF MMKAG DWRKASRQYS ERFNS+SLKLMR+ LQL Sbjct: 476 AIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 531
BLAST of CN186552 vs. ExPASy Swiss-Prot
Match: CDPKW_ARATH (Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1) HSP 1 Score: 92.4337 bits (228), Expect = 2.207e-18 Identity = 44/57 (77.19%), Postives = 49/57 (85.96%), Query Frame = -2 Query: 351 NAIMHDVDTDKDGRISYEEFAVMMKAGPDWRKASRQYSPERFNSISLKLMREEGLQL 521 +AI+ DVDTDKDGRISYEEF MMK G DWRKASRQYS ERFNSISLKLM++ LQ+ Sbjct: 477 DAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDASLQV 533
BLAST of CN186552 vs. ExPASy Swiss-Prot
Match: CDPKD_ARATH (Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2) HSP 1 Score: 87.0409 bits (214), Expect = 9.271e-17 Identity = 41/59 (69.49%), Postives = 46/59 (77.97%), Query Frame = -2 Query: 345 NAIMHDVDTDKDGRISYEEFAVMMKAGPDWRKASRQYSPERFNSISLKLMREEGLQLAN 521 N I +VDTDKDGRISYEEFA MMK G DWRKASR YS RFNS+S+KLM++ L L N Sbjct: 469 NDIFQEVDTDKDGRISYEEFAAMMKTGTDWRKASRHYSRGRFNSLSIKLMKDGSLNLGN 527
BLAST of CN186552 vs. ExPASy Swiss-Prot
Match: CDPKU_ARATH (Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 1.025e-15 Identity = 38/55 (69.09%), Postives = 46/55 (83.64%), Query Frame = -2 Query: 351 IMHDVDTDKDGRISYEEFAVMMKAGPDWRKASRQYSPERFNSISLKLMREEGLQL 515 IM +VDTDKDG+I+Y+EF VMMKAG DWRKASRQYS ERF S+SL LM++ + L Sbjct: 476 IMREVDTDKDGKINYDEFVVMMKAGTDWRKASRQYSRERFKSLSLNLMKDGSMHL 530
BLAST of CN186552 vs. ExPASy Swiss-Prot
Match: CDPKA_ARATH (Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 1.339e-15 Identity = 38/55 (69.09%), Postives = 45/55 (81.82%), Query Frame = -2 Query: 351 IMHDVDTDKDGRISYEEFAVMMKAGPDWRKASRQYSPERFNSISLKLMREEGLQL 515 IM +VDTDKDGRI+Y+EF MMKAG DWRKASRQYS ERF S+S+ LM++ L L Sbjct: 480 IMREVDTDKDGRINYDEFVTMMKAGTDWRKASRQYSRERFKSLSINLMKDGSLHL 534
BLAST of CN186552 vs. ExPASy Swiss-Prot
Match: CDPKE_ARATH (Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 3.297e-14 Identity = 37/55 (67.27%), Postives = 45/55 (81.82%), Query Frame = -2 Query: 354 AIMHDVDTDKDGRISYEEFAVMMKAGPDWRKASRQYSPERFNSISLKLMREEGLQ 518 AI+ DVDT+KDG+ISY+EFA MMK G DWRKASRQYS + F +SLKLM++ LQ Sbjct: 470 AIILDVDTNKDGKISYDEFATMMKTGTDWRKASRQYSRDLFKCLSLKLMQDGSLQ 524 The following BLAST results are available for this feature:
BLAST of CN186552 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 7
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN186552 ID=CN186552; Name=CN186552; organism=Citrus sinensis; type=EST; length=666bpback to top |