CN186268

Overview
NameCN186268
Unique NameCN186268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length836
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:890..1724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 9.410e-90
Identity = 162/178 (91.01%), Postives = 166/178 (93.26%), Query Frame = -1
Query:  303 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKSIVA+GLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGMM+INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ
Sbjct:  215 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMSINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 392          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK_MEDTR (S-adenosylmethionine synthetase OS=Medicago truncatula GN=METK PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.605e-89
Identity = 161/179 (89.94%), Postives = 166/179 (92.74%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAY+VRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPD+EIL+IVKE+FDFRPGM+TINLDLKRGGN RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA
Sbjct:  216 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYVVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDREILQIVKENFDFRPGMITINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 394          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK2_ELAUM (S-adenosylmethionine synthetase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 2.096e-89
Identity = 160/179 (89.39%), Postives = 166/179 (92.74%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPV+PEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVP+PLSVFVDSYGTGKIPDKEILKIVKE+FDFRPGM+TINLDLKRGGN RFLKTAAYGHFGRDDPDFTWE+VKPLKWEKPQ+
Sbjct:  215 IKPVVPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPDPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNDRFLKTAAYGHFGRDDPDFTWEIVKPLKWEKPQS 393          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 3.576e-89
Identity = 164/179 (91.62%), Postives = 166/179 (92.74%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGMMTINLDLKRGGN RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA
Sbjct:  215 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMTINLDLKRGGN-RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 392          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK2_VITVI (S-adenosylmethionine synthetase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 4.670e-89
Identity = 161/179 (89.94%), Postives = 166/179 (92.74%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPD+EILKIVKE+FDFRPGM++INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK QA
Sbjct:  215 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKTQA 393          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 6.100e-89
Identity = 159/179 (88.83%), Postives = 165/179 (92.18%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKSIVANGLARRC+VQVSYAIGVPEPLSVFVDSYGTG+IPDKEIL IVKE+FDFRPGM+TINLDLKRGGNGRFLKTA YGHFGRDDPDFTWE+VKPLKWEKPQ+
Sbjct:  215 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCLVQVSYAIGVPEPLSVFVDSYGTGQIPDKEILNIVKENFDFRPGMITINLDLKRGGNGRFLKTAGYGHFGRDDPDFTWEIVKPLKWEKPQS 393          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK5_VITVI (S-adenosylmethionine synthetase 5 OS=Vitis vinifera GN=METK5 PE=3 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 1.040e-88
Identity = 161/176 (91.48%), Postives = 163/176 (92.61%), Query Frame = -1
Query:  309 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKE+FDFRPGM+ INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK
Sbjct:  215 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK_BRARP (S-adenosylmethionine synthetase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 2.318e-88
Identity = 158/179 (88.27%), Postives = 165/179 (92.18%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKP+IPEKYLD+KTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  215 IKPIIPEKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK5_BRAJU (S-adenosylmethionine synthetase 5 OS=Brassica juncea GN=MSAMS5 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 2.318e-88
Identity = 158/179 (88.27%), Postives = 165/179 (92.18%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKP+IPEKYLD+KTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  215 IKPIIPEKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK3_BRAJU (S-adenosylmethionine synthetase 3 OS=Brassica juncea GN=MSAMS3 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 2.318e-88
Identity = 158/179 (88.27%), Postives = 165/179 (92.18%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKP+IPEKYLD+KTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  215 IKPIIPEKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
The following BLAST results are available for this feature:
BLAST of CN186268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK1_SOLTU9.410e-9091.01S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK_MEDTR1.605e-8989.94S-adenosylmethionine synthetase OS=Medicago trunca... [more]
METK2_ELAUM2.096e-8989.39S-adenosylmethionine synthetase 2 OS=Elaeagnus umb... [more]
METK1_POPTR3.576e-8991.62S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK2_VITVI4.670e-8989.94S-adenosylmethionine synthetase 2 OS=Vitis vinifer... [more]
METK1_ELAUM6.100e-8988.83S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]
METK5_VITVI1.040e-8891.48S-adenosylmethionine synthetase 5 OS=Vitis vinifer... [more]
METK_BRARP2.318e-8888.27S-adenosylmethionine synthetase OS=Brassica rapa s... [more]
METK5_BRAJU2.318e-8888.27S-adenosylmethionine synthetase 5 OS=Brassica junc... [more]
METK3_BRAJU2.318e-8888.27S-adenosylmethionine synthetase 3 OS=Brassica junc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002K05_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002K05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186268 ID=CN186268; Name=CN186268; organism=Citrus sinensis; type=EST; length=836bp
TTTTTTTTTTTTTAGCAAAAGGAAGAATTTTACTAATTCCAGGCACCTTT
TTGAGCAAAATTCTCAATCGATATCACTACACAACAGTGGTGACATGGTA
CATTAAACCAAAACCAAAAAAGAAGTGGGGAAAGAAGAAAAAGAAAGGAA
TTGAATGGGGAACATGTATGAGTTCTGAACACAGGAGATTTGCTTAGTAT
TACAAAGCAGCAGCAAGATAATATTCAAATTATTCATCCACTACCAATAG
AAGCAAACTTGAACAGCAGGGATAGTTTTCACTTTTCAACTCAAATTTAA
GCTTGAGGCTTTTCCCACTTGAGGGGCTTCACAACTTCCCAAGTGAAGTC
TGGGTCATCCCTGCCAAAGTGTCCATAGGCAGCAGTCTTCAAGAACCTGC
CATTACCGCCCCTTTTGAGATCCAAATTGATGGTCATCATTCCTGGCCTG
AAATCAAAGCTTTCCTTCACAATTTTGAGGATCTCCTTGTCAGGAATCTT
GCCGGTTCCATATGAGTCCACAAAAACAGACAATGGCTCAGGCACACCAA
TGGCATAGGAGACTTGGACAATGCACCTGCGAGCAAGCCCGTTTGCAACA
ATGCTCTTAGCAGCCTGCCTAACAATGTATGCACCACTCCTATCCACCTT
AGTAGGGTCTTTTCCAGAGAAAGCACCGCCACCATGGGCTCCCCAGCCAC
CATAAGTGTCGATGATGATCTTACGTCCAGTGAGACCAGCATCACCATGA
GGCCCACCAATGACAAAACGACCTGATGGATTAAGGTGGAAGATGGTCTT
CTCATCAAGGTACTTCTCGGGGATGACAGGCTTAAT
back to top