CN186193

Overview
NameCN186193
Unique NameCN186193
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9308 contig Csv1_Contig9308:381..1111. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186193 vs. ExPASy Swiss-Prot
Match: ANAG_HUMAN (Alpha-N-acetylglucosaminidase OS=Homo sapiens GN=NAGLU PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.942e-19
Identity = 35/86 (40.70%), Postives = 54/86 (62.79%), Query Frame = -1
Query:  467 KLFLNAGNALAGSATYRYDLVDITRQALSKLANQVYMDAVIAFQHKD-ASAFNIHSQKFLQLIKDIDELLASNDNFLLGTWLESAK 721
            +L L +  +LA S  +RYDL+D+TRQA+ +L +  Y +A  A+  K+ AS          +L+  +DE+LAS+  FLLG+WLE A+
Sbjct:  541 RLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLASDSRFLLGSWLEQAR 626          

HSP 2 Score: 51.9878 bits (123), Expect = 1.942e-19
Identity = 33/121 (27.27%), Postives = 63/121 (52.07%), Query Frame = -3
Query:  114 KCKKLATNPSEMIQYEYNARTQVTMWYDPNIITQSKLHDYANKFWSGLLVDYYFPRAFTYFDYMSKSLREKSEFQVDRWRQQWVFISISWQSNWKPGPKNYPIRAKGDFIAIAKVLYDKYF 476
            + +  A + +E   YE N+R Q+T+W       +  + DYANK  +GL+ +YY PR   + + +  S+ +   FQ  ++ +  VF     +  +    + YP + +GD + +AK ++ KY+
Sbjct:  624 QARAAAVSEAEADFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKN-VF---QLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYY 735          
The following BLAST results are available for this feature:
BLAST of CN186193 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
ANAG_HUMAN1.942e-1940.70Alpha-N-acetylglucosaminidase OS=Homo sapiens GN=N... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002I06_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002I06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186193 ID=CN186193|Name=CN186193|organism=Citrus sinensis|type=EST|length=730bp
TTTTTTTTTTTTTTTTTAAAAATTGAGAATCATTTTATTACAAACAACTC
TATAACGAATTGTTCAGTCATCCCCTAACCATTGGGGGGAGCTCACTTGA
TTAATTGCTGACCAAAATATTTATCATACAATACTTTAGCAATAGCAATA
AAATCTCCTTTGGCTCTTATTGGGTAATTTTTCGGACCGGGTTTCCAATT
TGATTGCCAACTGATTGAAATAAAGACCCATTGTTGCCTCCATCTGTCCA
CCTGGAATTCAGACTTCTCTCTCAAGCTTTTAGACATATAATCGAAATAC
GTAAAAGCTCGGGGAAAATAGTAGTCTACTAATAATCCACTCCAGAATTT
GTTTGCGTAATCATGAAGCTTGCTCTGTGTAATAATGTTGGGGTCATACC
ACATTGTCACTTGTGTCCTTGCGTTGTACTCGTACTGAATCATTTCACTA
GGATTTGTCGCCAATTTTTTGCACTTTCAAGCCATGTTCCAAGAAGAAAA
TTGTCATTGGAAGCAAGTAGCTCATCAATATCCTTTATGAGCTGAAGAAA
CTTTTGGCTATGAATATTAAAAGCACTGGCATCCTTATGCTGAAAAGCAA
TCACTGCATCCATGTATACTTGGTTTGCTAGCTTTGACAGTGCCTGCCTT
GTTATGTCAACCAAGTCATATCTATATGTGGCGCTTCCAGCTAGAGCATT
ACCAGCATTCAAGAATAGTTTTAAACCCTT
back to top