CV998073

Overview
NameCV998073
Unique NameCV998073
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length924
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9802 contig Csv1_Contig9802:46..970. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 323.553 bits (828), Expect = 1.018e-87
Identity = 149/253 (58.89%), Postives = 183/253 (72.33%), Query Frame = 3
Query:  150 GGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQ-YYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPYGPYLMAXSM 905
            GG+LG IIS  MF+ +L +RND  C  +GFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC++R+                 PG+ Y+GRGPIQ++ N NY  CG A+GVDLLNNPDL+ATDPV+SFKSA+WFWMT Q PKPSCH+VII  W+PSA D  A RLPG+G+ TNIINGG+ECG   +  V++RIGF+  +C   G  PGDNLDC   R +G  L+  +M
Sbjct:   77 GGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQRSFGNGLLVDTM 329          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 2.268e-87
Identity = 154/272 (56.62%), Postives = 190/272 (69.85%), Query Frame = 3
Query:   99 CGSGVVCGERDTGHGTD--GGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQ-YYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPYGPYLMAXSM 905
            CG G  C  +  G  T   GG+LG IIS  MF+ +L +RND  C  +GFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC++R+                 PG+ Y+GRGPIQ++ N NY  CG A+GVDLLNNPDL+ATDPV+SFKSA+WFWMT Q PKPSCH+VII  W+PS+ D  A RLPG+G+ TNIINGG+ECG   +  V++RIGF+  +C   G  PGDNLDC   R +G  L+  +M
Sbjct:   54 CGPGN-CQSQCPGGPTPPGGGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQRSFGNGLLVDTM 324          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 317.39 bits (812), Expect = 7.296e-86
Identity = 145/243 (59.67%), Postives = 178/243 (73.25%), Query Frame = 3
Query:  153 GELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQ-YYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPY 878
            G+L  IIS   F+D+L +RNDA CPARGFYTY+AFI AA++FPGFG +G+   RK+E+AAFF QT HETTGGW  AP G Y+WGYC+ ++ +PAS             G+ YYGRGP+QL+WN NY  CG A+GVDLLNNPDL+A D V++FK+AIWFWMTAQPPKPSCH VI  +W+PS  D  AGRLPGYG+ TNIINGG+ECG   +  V +RIGF+  +C  FG  PG NLDC   R +
Sbjct:   84 GDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAIGVDLLNNPDLVANDAVIAFKAAIWFWMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGFYQRYCNIFGVNPGGNLDCYNQRSF 326          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 316.62 bits (810), Expect = 1.244e-85
Identity = 148/273 (54.21%), Postives = 188/273 (68.86%), Query Frame = 3
Query:   87 SAQNCGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQYYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPYGPYLMAXSM 905
            +++ CG G  C  + +G  + GG L  +IS + F ++L +RND  C  + FYTYDAF+ AA+AFP F N G+   +KREIAAF  QT HETTGGW  AP G YAWGYC++R+ +P++              QYYGRGPIQ++WN NY +CG A+GVDLLNNPDL+ATDPV+SFK+A+WFWMT Q PKPSCH+VI   W PS+ D  AGRLPGYG  TNIINGG+ECG   +  V++RIGF+  +C  FG   GDNLDC   RP+G  L   S+
Sbjct:   47 TSEYCGDG--CQSQCSG-SSGGGTLSSLISGDTFNNMLKHRNDNACQGKPFYTYDAFLSAAKAFPNFANKGDTATKKREIAAFLGQTSHETTGGWPTAPDGPYAWGYCFLREQNPSTYCQASSEFPCASGKQYYGRGPIQISWNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGGWTPSSADRAAGRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFYKRYCDIFGIGYGDNLDCYSQRPFGSSLPLSSI 316          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.772e-85
Identity = 149/272 (54.78%), Postives = 185/272 (68.01%), Query Frame = 3
Query:   99 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQYYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPYGPYLMAXSM*SS 914
            CG G  C  +  G      +L  +ISR  F+ +L +RND  CPA+GFYTYDAFI AA+A+P FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYC++R+ +P++              QYYGRGPIQ++WN NY +CG A+GVDLLN PDL+ATD V+SFKSA+WFWMTAQ PKPS H+VI   W PS+ DV A RLPGYG  TNIINGG+ECG   +  V++RIGFF  +C   G   G+NLDC    P+G  L+   + +S
Sbjct:   58 CGPG--CQSQCGGPSPAPTDLSALISRSTFDQMLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPSTYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVGYGNNLDCYSQTPFGNSLLLSDLVTS 327          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.772e-85
Identity = 141/240 (58.75%), Postives = 179/240 (74.58%), Query Frame = 3
Query:  165 KIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQ-YYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPYG 881
            KIISR MF+ +L +RN+  CPA+GFYTYDAF+ AA++FP FG +G+  +RKRE+AAF  QT HETTGGW  AP G YAWGYC++++ +P+S+           PG+ YYGRGP+QL+WN NY  CGEAL V+LL NPDL+ATD VLSFK+A+WFWMT Q PKPSCH+V+   W+PSA D  AGRLPGYG+ TN++NGG+ECG   N  V +R+GFF  +CG  G   G+NLDC   RP+G
Sbjct:    4 KIISRSMFDQMLKHRNNPACPAKGFYTYDAFLAAAKSFPSFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPSPRYPCAPGKSYYGRGPLQLSWNYNYGPCGEALRVNLLGNPDLVATDRVLSFKTALWFWMTPQAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGFFRRYCGLLGVGTGNNLDCYNQRPFG 243          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.772e-85
Identity = 149/256 (58.20%), Postives = 179/256 (69.92%), Query Frame = 3
Query:  117 CGERDTGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGG--WTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQYYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPY 878
            C  + +G G D G L  +I+RE F+ +L +RND  CPARGFYTYDAFI AA++FP F  +G++  RKRE+AAF AQT HETTGG  W  AP G Y WGYCY R+++PA               QY+GRGP+QLTWN NY +CG A+GVDLLNNPDLLATDP +SFKSA WFWMT Q PKPSCH+VII  W PS +D  AGR+PG+GL TNIINGG+ECG   N  V +RIGF+  +C   G   G+NLDC   R Y
Sbjct:   58 CQSQCSGSGGDTGGLDSLITRERFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWA-APDGPYTWGYCYNRELNPADYCQWDPNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAIGVDLLNNPDLLATDPTISFKSAFWFWMTPQSPKPSCHDVIIGAWSPSGSDQAAGRVPGFGLITNIINGGLECGQGWNAKVEDRIGFYKRYCDTLGVGYGNNLDCYNQRSY 312          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.376e-84
Identity = 150/277 (54.15%), Postives = 185/277 (66.79%), Query Frame = 3
Query:   99 CGS-----GVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQYYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPYGPYLMAXSM*SS 914
            CGS     G  C  +  G      +L  +ISR  F+ +L +RND  CPA+GFYTYDAFI AA+A+P FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYC++R+ +P++              QYYGRGPIQ++WN NY +CG A+GVDLLN PDL+ATD V+SFKSA+WFWMTAQ PKPS H+VI   W PS+ DV A RLPGYG  TNIINGG+ECG   +  V++RIGFF  +C   G   G+NLDC    P+G  L    + +S
Sbjct:   50 CGSTTDYCGKDCQSQCGGPSPAPTDLSALISRSTFDQVLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPSAYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVGYGNNLDCYSQTPFGNSLFLSDLVTS 326          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.376e-84
Identity = 151/261 (57.85%), Postives = 182/261 (69.73%), Query Frame = 3
Query:  132 TGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGG--WTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPG-QYYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPYGPYLMAXSM 905
            +G     G L  +ISRE F  +L +RND  CPARGFYTYDAFI AA++FP F  +G++  RKREIAAF AQT HETTGG  W  AP G YAWGYCY R+++P SS           PG QY+GRGP+QL+WN NY +CG A+GVDLLNNPDLL++DP +SFKSA WFWMT Q PKPSCH VII  W PS++D  AGR+PGYG+ TNIINGG+ECG   N  V +RIGF+  +C   G   G+NLDC    P+G  +   SM
Sbjct:   65 SGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSYGNNLDCYNQSPFGNGVSVDSM 324          
BLAST of CV998073 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.797e-84
Identity = 141/243 (58.02%), Postives = 178/243 (73.25%), Query Frame = 3
Query:  153 GELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWTDAPGGEYAWGYCYIRQVSPASSDXXXXXXXXXLPGQ-YYGRGPIQLTWNCNYLRCGEALGVDLLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGDQPGDNLDCSQPRPY 878
            G+L  IISR  F+D+L +RND  CPARGFYTYDAFI AA++FPGFG +G+   RK+EIAAFF QT HETTGGW  AP G Y+WGYC+ ++ +P+S+            G+ YYGRGP+QL+WN NY +CG A+G DLLNNPDL++ DPV++FK+AIWFWMT Q PKPSCH VI+ +W+PS  D  AGR+PGYG+ TNIINGG+ECG   +  V +RIGF+  +C   G  PG NLDC   R +
Sbjct:   69 GDLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQCGRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMTPQSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDARVADRIGFYQRYCNILGVNPGGNLDCYNQRSF 311          
The following BLAST results are available for this feature:
BLAST of CV998073 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI1_TOBAC1.018e-8758.89Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHI2_TOBAC2.268e-8756.62Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHIB_ARATH7.296e-8659.67Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI2_PEA1.244e-8554.21Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHIT_PHAVU2.772e-8554.78Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHIT_CARPA2.772e-8558.75Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI1_THECC2.772e-8558.20Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHI5_PHAVU1.376e-8454.15Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI1_GOSHI1.376e-8457.85Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI2_BRANA1.797e-8458.02Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_CTMN-3_T3 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC03_C01_011, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998073 ID=CV998073|Name=CV998073|organism=Citrus sinensis|type=EST|length=924bp
ATTGATATCATAACTCTTGCTTTCAAATGAGGCTCATTGGGTCCTTACTA
ATTTTCTCTCTAGTTTTATCTTTTGTACTAGGAGGTTCAGCACAGAATTG
TGGAAGCGGCGTTGTGTGCGGTGAACGTGATACTGGCCACGGGACGGATG
GCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTTTGAAGACTTGCTT
CCGTATAGAAATGATGCCCGATGCCCTGCCAGAGGCTTCTACACTTATGA
TGCTTTTATAGAGGCAGCCCAAGCTTTTCCAGGCTTTGGTAACTCTGGAA
ATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTTTTGCCCAAACTGGC
CATGAAACTACTGGGGGATGGACCGATGCACCTGGTGGAGAATATGCTTG
GGGATATTGCTATATTAGGCAAGTTAGCCCTGCGTCGTCCGACTACTGTT
ATCCTTACTGTCCATGTCCCTTGCCAGGGCAATACTATGGCCGAGGTCCA
ATTCAACTCACTTGGAATTGCAATTACTTAAGGTGCGGAGAAGCCTTGGG
GGTGGACTTGTTGAACAATCCAGACCTACTTGCCACTGATCCAGTACTAT
CATTCAAGTCAGCAATCTGGTTCTGGATGACTGCACAGCCACCAAAGCCA
TCGTGCCACGAAGTCATTATCGACGAATGGAAACCATCAGCAAATGACGT
AAACGCCGGCCGGCTTCCGGGATACGGTCTAACCACAAATATAATCAACG
GTGGAATTGAATGTGGCTACGTTGGGAATGACGCTGTACGTAACCGTATT
GGGTTCTTTACCACTTTCTGTGGCAAGTTTGGGGATCAGCCTGGTGACAA
TCTTGATTGCTCCCAACCACGGCCTTATGGGCCTTATCTGATGGCANCAT
CTATGTGATCATCATGATCAACGT
back to top