CV998064

Overview
NameCV998064
Unique NameCV998064
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length476
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12923 contig Csv1_Contig12923:623..1097. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.341e-27
Identity = 48/84 (57.14%), Postives = 61/84 (72.62%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLMAQSM 294
            CH VII  W PS++D  A R+PGYG+ TNIINGG+ECGKGWN+ V +RIGF+  +C   G+  G+NLDCYNQ P+G  +   SM
Sbjct:  241 CHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSYGNNLDCYNQSPFGNGVSVDSM 324          

HSP 2 Score: 29.261 bits (64), Expect = 1.341e-27
Identity = 10/12 (83.33%), Postives = 10/12 (83.33%), Query Frame = 3
Query:    6 WFWMTAQPPKPS 41
            WFWMT Q PKPS
Sbjct:  229 WFWMTPQSPKPS 240          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 1.877e-26
Identity = 47/84 (55.95%), Postives = 59/84 (70.24%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLMAQSM 294
            CH VII  W PS++D  A R  GYG+ TNIINGG+ECGKGWN+ V +RIGF+  +C   G+  G+NLDCYNQ P+G  +   SM
Sbjct:  219 CHNVIIGAWSPSSSDRAAGRATGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSYGNNLDCYNQSPFGNGVSVDSM 302          

HSP 2 Score: 29.261 bits (64), Expect = 1.877e-26
Identity = 10/12 (83.33%), Postives = 10/12 (83.33%), Query Frame = 3
Query:    6 WFWMTAQPPKPS 41
            WFWMT Q PKPS
Sbjct:  207 WFWMTPQSPKPS 218          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 2.439e-26
Identity = 47/84 (55.95%), Postives = 62/84 (73.81%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLMAQSM 294
            CH+VII  W+PSA D  A+RLPG+G+ TNIINGG+ECG+G +S V +RIGF+  +C   G+ PGDNLDC NQ  +G  L+  +M
Sbjct:  246 CHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQRSFGNGLLVDTM 329          

HSP 2 Score: 30.0314 bits (66), Expect = 2.439e-26
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 3
Query:    3 IWFWMTAQPPKPS 41
            +WFWMT Q PKPS
Sbjct:  233 LWFWMTPQSPKPS 245          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.455e-26
Identity = 45/76 (59.21%), Postives = 58/76 (76.32%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYG 270
            CH+V+   W+PSA D  A RLPGYG+ TN++NGG+ECGKG N  VA+R+GFF  +CG  G+  G+NLDCYNQ P+G
Sbjct:  168 CHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGFFRRYCGLLGVGTGNNLDCYNQRPFG 243          

HSP 2 Score: 30.0314 bits (66), Expect = 2.455e-26
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 3
Query:    3 IWFWMTAQPPKPS 41
            +WFWMT Q PKPS
Sbjct:  155 LWFWMTPQAPKPS 167          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 3.173e-26
Identity = 45/80 (56.25%), Postives = 57/80 (71.25%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLM 282
            CH VI  +W+PS  D  A RLPGYG+ TNIINGG+ECG+G +  VA+RIGF+  +C  FG+ PG NLDCYNQ  +   L+
Sbjct:  252 CHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGFYQRYCNIFGVNPGGNLDCYNQRSFVNGLL 331          

HSP 2 Score: 35.8094 bits (81), Expect = 3.173e-26
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 3
Query:    3 IWFWMTAQPPKPS 41
            IWFWMTAQPPKPS
Sbjct:  239 IWFWMTAQPPKPS 251          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.010e-25
Identity = 46/84 (54.76%), Postives = 58/84 (69.05%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLMAQSM 294
            CH+VII  W PS +D  A R+PG+GL TNIINGG+ECG+GWN+ V +RIGF+  +C   G+  G+NLDCYNQ  Y       SM
Sbjct:  238 CHDVIIGAWSPSGSDQAAGRVPGFGLITNIINGGLECGQGWNAKVEDRIGFYKRYCDTLGVGYGNNLDCYNQRSYNNGPSVDSM 321          

HSP 2 Score: 29.261 bits (64), Expect = 2.010e-25
Identity = 10/12 (83.33%), Postives = 10/12 (83.33%), Query Frame = 3
Query:    6 WFWMTAQPPKPS 41
            WFWMT Q PKPS
Sbjct:  226 WFWMTPQSPKPS 237          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 2.616e-25
Identity = 48/84 (57.14%), Postives = 60/84 (71.43%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLMAQSM 294
            CH+VI   W PS+ D  A RLPGYG  TNIINGG+ECG+G +S V +RIGF+  +C  FGI  GDNLDCY+Q P+G +L   S+
Sbjct:  233 CHDVITGGWTPSSADRAAGRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFYKRYCDIFGIGYGDNLDCYSQRPFGSSLPLSSI 316          

HSP 2 Score: 30.0314 bits (66), Expect = 2.616e-25
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 3
Query:    3 IWFWMTAQPPKPS 41
            +WFWMT Q PKPS
Sbjct:  220 LWFWMTPQSPKPS 232          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHI1_SOLTU (Endochitinase 1 (Fragment) OS=Solanum tuberosum GN=CHTB1 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.406e-25
Identity = 45/84 (53.57%), Postives = 60/84 (71.43%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLMAQSM 294
            CH+VI   W+PS  D  A+R+PG+G+ TNIINGG+ECG G +S V +RIGF+  +CG  G+ PGDNLDC NQ  +G  L+  +M
Sbjct:  235 CHDVITGRWQPSGVDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGVSPGDNLDCGNQRSFGNGLLVDTM 318          

HSP 2 Score: 30.8018 bits (68), Expect = 3.406e-25
Identity = 11/13 (84.62%), Postives = 11/13 (84.62%), Query Frame = 3
Query:    3 IWFWMTAQPPKPS 41
            IWFWMT Q PKPS
Sbjct:  222 IWFWMTPQSPKPS 234          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHI3_TOBAC (Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.429e-25
Identity = 44/84 (52.38%), Postives = 59/84 (70.24%), Query Frame = 1
Query:   43 CHEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLMAQSM 294
            CH+VI   W PSA D  A+RLPGYG+ TNIINGG+ECG G ++ V +RIGF+  +C   G+ PGDN+DC NQ  +   L+ ++M
Sbjct:  251 CHDVITGRWTPSAADRAANRLPGYGVITNIINGGLECGHGSDARVQDRIGFYRRYCSILGVSPGDNIDCGNQKSFNSGLLLETM 334          

HSP 2 Score: 32.7278 bits (73), Expect = 4.429e-25
Identity = 12/13 (92.31%), Postives = 12/13 (92.31%), Query Frame = 3
Query:    3 IWFWMTAQPPKPS 41
            IWFWMTAQ PKPS
Sbjct:  238 IWFWMTAQSPKPS 250          
BLAST of CV998064 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 4.430e-25
Identity = 46/86 (53.49%), Postives = 61/86 (70.93%), Query Frame = 1
Query:   46 HEVIIDEWKPSANDVNASRLPGYGLTTNIINGGIECGKGWNSFVANRIGFFTTFCGKFGIQPGDNLDCYNQGPYGPNLMAQSM*SS 303
            H+VI   W PS+ DV A RLPGYG  TNIINGG+ECG+G +S V +RIGFF  +C   G+  G+NLDCY+Q P+G +L+   + +S
Sbjct:  242 HDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVGYGNNLDCYSQTPFGNSLLLSDLVTS 327          

HSP 2 Score: 31.9574 bits (71), Expect = 4.430e-25
Identity = 11/13 (84.62%), Postives = 12/13 (92.31%), Query Frame = 3
Query:    3 IWFWMTAQPPKPS 41
            +WFWMTAQ PKPS
Sbjct:  228 LWFWMTAQSPKPS 240          
The following BLAST results are available for this feature:
BLAST of CV998064 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
CHI1_GOSHI1.341e-2757.14Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI2_GOSHI1.877e-2655.95Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHI1_TOBAC2.439e-2655.95Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHIT_CARPA2.455e-2659.21Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHIB_ARATH3.173e-2656.25Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI1_THECC2.010e-2554.76Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHI2_PEA2.616e-2557.14Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHI1_SOLTU3.406e-2553.57Endochitinase 1 (Fragment) OS=Solanum tuberosum GN... [more]
CHI3_TOBAC4.429e-2552.38Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3... [more]
CHIT_PHAVU4.430e-2553.49Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_B-4_T3 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC28_D04_026, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998064 ID=CV998064|Name=CV998064|organism=Citrus sinensis|type=EST|length=476bp
CAATCTGGTTCTGGATGACTGCACAGCCACCAAAGCCATCGTTGCCACGA
AGTCATTATCGACGAATGGAAACCATCAGCAAATGACGTAAACGCCAGCC
GGCTTCCGGGATACGGTCTAACCACAAATATAATCAACGGTGGAATTGAA
TGTGGCAAAGGTTGGAATAGCTTTGTAGCTAACCGTATTGGGTTCTTTAC
CACTTTCTGTGGCAAGTTTGGGATTCAGCCTGGCGACAATCTTGATTGCT
ACAACCAAGGGCCTTATGGCCCTAATTTGATGGCACAATCTATGTGATCA
TCATGATCAACGTTTTAGTAAAATAAGCTTAATAAAAGCTACTTAATAAA
AACTTTAGATGTCACACTTGTAGGTGGACAACTAAATTGTTAGTTTGTTA
CGCTCTTATTGTAGGTAAATTAAATAAGACTGATCCAACATGGATCAATG
AGTCTTCTCCAAAAAAAAAAAAAAAA
back to top