CV998062

Overview
NameCV998062
Unique NameCV998062
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length953
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CV998062_ssr762 microsatellite CV998062_ssr762:762..773. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3336 contig Csv1_Contig3336:283..1235. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA_ORYSJ (Probable succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0577700 PE=1 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 1.209e-131
Identity = 237/278 (85.25%), Postives = 244/278 (87.77%), Query Frame = -1
Query:  120 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQRGL 953
            GKNGTFHT QAIEYGT MVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPF           ELDLVVCITEGIPQHDMV+VKAALN+QSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDCLEKF+ DPQT              EDAAA I+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIK LREAGVTVVESPAKIGS M E+FKQRG+
Sbjct:   52 GKNGTFHTEQAIEYGTTMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGM 329          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA2_ARATH (Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial OS=Arabidopsis thaliana GN=At5g23250 PE=1 SV=2)

HSP 1 Score: 465.307 bits (1196), Expect = 2.280e-130
Identity = 233/278 (83.81%), Postives = 245/278 (88.13%), Query Frame = -1
Query:  120 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQRGL 953
            GKNGTFHT QAIEYGTKMV GVTPKKGGTEHLGLPVFN+VAEAKAETKANASVIYVP PF           ELDL+VCITEGIPQHDMVRVKAALN QSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPG++GIVSRSGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDCLEKF VDPQT              EDAAALIKE+GT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIK+LR+AGV VVESPAKIG+AM E+F++RGL
Sbjct:   62 GKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFELFQERGL 339          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA1_ARATH (Succinyl-CoA ligase [GDP-forming] subunit alpha-1, mitochondrial OS=Arabidopsis thaliana GN=At5g08300 PE=1 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 2.521e-129
Identity = 233/278 (83.81%), Postives = 242/278 (87.05%), Query Frame = -1
Query:  120 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQRGL 953
            GKNGTFHT QAIEYGTKMV GVTPKKGGTEHLGLPVFNSVAEAKA+TKANASVIYVP PF           ELDL+VCITEGIPQHDMVRVK ALN QSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPG++GIVSRSGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDCLEKF VDPQT              EDAAALIK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIK+L +AGV VVESPAKIGSAM E+F++RGL
Sbjct:   67 GKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASVIYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGSAMYELFQERGL 344          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA_DICDI (Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=scsA PE=1 SV=3)

HSP 1 Score: 374.015 bits (959), Expect = 6.914e-103
Identity = 184/276 (66.67%), Postives = 215/276 (77.90%), Query Frame = -1
Query:  126 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQR 953
            G  GTFH+ QAIEYGT MVGGV+P KGG +HL LPVFN+V EAK  T ANA+VIYVPPP            E++LVVCITEGIPQ DMV+VK  LN+Q+KTRLIGPNCPGIIKPGECKIGIMPG+IHKPG++GIVSRSGTLTYEAV QTT VGLGQSTC+GIGGDPFNGTNF+DCL+ F  DPQT              E+AA  + ++ T+KPVV+FIAGL+APPGRRMGHAGAI+SGGKG A  KI+ L+ AGVTV  SPAK+G  +L+   ++
Sbjct:   37 GNQGTFHSKQAIEYGTNMVGGVSPGKGGQKHLDLPVFNTVKEAKEATGANATVIYVPPPHAAAAIKEAIDAEMELVVCITEGIPQQDMVKVKYLLNKQNKTRLIGPNCPGIIKPGECKIGIMPGHIHKPGKIGIVSRSGTLTYEAVAQTTAVGLGQSTCIGIGGDPFNGTNFIDCLKMFTQDPQTEGIILIGEIGGEAEEEAAQWLIDNPTDKPVVSFIAGLSAPPGRRMGHAGAIISGGKGDANSKIEALKAAGVTVTFSPAKLGETILQKMNEK 312          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA_RAT (Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial OS=Rattus norvegicus GN=Suclg1 PE=2 SV=2)

HSP 1 Score: 367.851 bits (943), Expect = 4.955e-101
Identity = 185/279 (66.31%), Postives = 213/279 (76.34%), Query Frame = -1
Query:  126 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQR 953
            GK GTFH+ QA+EYGTK+VGG TP KGG +HLGLPVFN+V EAK +T A ASVIYVPPPF           E+ LVVCITEGIPQ DMVRVK  L RQ KTRLIGPNCPGII PGECKIGIMPG+IHK GR+GIVSRSGTLTYEAV QTT VGLGQS C+GIGGDPFNGTNF+DCL+ FL DP T              E+AA  +KE  +    KPVV+FIAG+TAPPGRRMGHAGAI++GGKG A++KI  L+ AGV V  SPA++G+ M + F++R
Sbjct:   65 GKQGTFHSQQALEYGTKLVGGTTPGKGGKKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHKLTRQGKTRLIGPNCPGIINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLDVFLKDPATEGIVLIGEIGGHAEENAAEFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVIVSMSPAQLGTCMYKEFEKR 343          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA_MOUSE (Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial OS=Mus musculus GN=Suclg1 PE=1 SV=4)

HSP 1 Score: 364.77 bits (935), Expect = 4.194e-100
Identity = 183/279 (65.59%), Postives = 213/279 (76.34%), Query Frame = -1
Query:  126 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQR 953
            GK GTFH+ QA+EYGTK+VGG TP KGG +HLGLPVFN+V EAK +T A ASVIYVPPPF           E+ LVVCITEGIPQ DMVRVK  L RQ  TRLIGPNCPG+I PGECKIGIMPG+IHK GR+GIVSRSGTLTYEAV QTT VGLGQS C+GIGGDPFNGT+F+DCLE FL DP T              E+AAA +KE  +    KPVV+FIAG+TAPPGRRMGHAGAI++GGKG A++KI  L+ AGV V  SPA++G+ + + F++R
Sbjct:   65 GKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHRLTRQGTTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCLEVFLNDPATEGIILIGEIGGHAEENAAAFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKR 343          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA_BOVIN (Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial OS=Bos taurus GN=SUCLG1 PE=2 SV=3)

HSP 1 Score: 363.229 bits (931), Expect = 1.220e-99
Identity = 185/279 (66.31%), Postives = 211/279 (75.63%), Query Frame = -1
Query:  126 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQR 953
            GK GTFH+ QA+EYGTK+VGG TP KGG  HLGLPVFN+V EAK +T A ASVIYVPPPF           E+ LVVCITEGIPQ DMVRVK  L RQ KTRL+GPNCPG+I PGECKIGIMPG+IHK GRVGIVSRSGTLTYEAV QTT VGLGQS CVGIGGDPFNGT+F DCLE FL DP T              E+AA  +K+  +    KPVV+FIAGLTAPPGRRMGHAGAI++GGKG A++KI  L+ AGV V  SPA++G+ M + F++R
Sbjct:   65 GKQGTFHSQQALEYGTKLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAVAAIDEAIEAEVSLVVCITEGIPQQDMVRVKHKLLRQGKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRVGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAGVVVSMSPAQLGTTMYKEFEKR 343          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA_HUMAN (Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens GN=SUCLG1 PE=1 SV=4)

HSP 1 Score: 360.533 bits (924), Expect = 7.910e-99
Identity = 183/279 (65.59%), Postives = 211/279 (75.63%), Query Frame = -1
Query:  126 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQR 953
            GK GTFH+ QA+EYGTK+VGG TP KGG  HLGLPVFN+V EAK +T A ASVIYVPPPF           E+ LVVCITEGIPQ DMVRVK  L RQ KTRLIGPNCPG+I PGECKIGIMPG+IHK GR+GIVSRSGTLTYEAV QTT VGLGQS CVGIGGDPFNGT+F+DCLE FL D  T              E+AA  +K+  +    KPVV+FIAGLTAPPGRRMGHAGAI++GGKG A++KI  L+ AGV V  SPA++G+ + + F++R
Sbjct:   65 GKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFIDCLEIFLNDSATEGIILIGEIGGNAEENAAEFLKQHNSGPNSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKR 343          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCA_PIG (Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial OS=Sus scrofa GN=SUCLG1 PE=1 SV=2)

HSP 1 Score: 359.762 bits (922), Expect = 1.349e-98
Identity = 183/279 (65.59%), Postives = 210/279 (75.27%), Query Frame = -1
Query:  126 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQR 953
            GK GTFH+ QA+EYGT +VGG TP KGG  HLGLPVFN+V EAK +T A ASVIYVPPPF           E+ LVVCITEGIPQ DMVRVK  L RQ KTRLIGPNCPG+I PGECKIGIMPG+IHK GR+GIVSRSGTLTYEAV QTT VGLGQS CVGIGGDPFNGT+F DCLE FL DP T              E+AA  +K+  +    KPVV+FIAGLTAPPGRRMGHAGAI++GGKG A++KI  L+ AGV V  SPA++G+ + + F++R
Sbjct:   65 GKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKR 343          
BLAST of CV998062 vs. ExPASy Swiss-Prot
Match: SUCD_RICBR (Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia bellii (strain RML369-C) GN=sucD PE=3 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 5.669e-97
Identity = 177/272 (65.07%), Postives = 208/272 (76.47%), Query Frame = -1
Query:  138 GKNGTFHTXQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTXXXXXXXXXXXXXXEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEV 953
            G  GTFH+ QAI YGTKMVGGVTP KGG  HL LP++N+V EAKA+T ANASVIYVPPPF            +++VVCITEGIP  DMVRVK AL   S+TRLIGPNCPGII P ECKIGIMPG+IH+ G +GIVSRSGTLTYEAV QTT VGLGQSTCVGIGGDP NGTNFVDC++ FL D +T              E+AA  IK S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK++ L+ AGVT+  SPA IG  ML++
Sbjct:   18 GSQGTFHSEQAIAYGTKMVGGVTPGKGGKTHLDLPIYNTVHEAKAKTGANASVIYVPPPFAADSILEAIDAGIEIVVCITEGIPVLDMVRVKRALVG-SRTRLIGPNCPGIITPDECKIGIMPGHIHRKGSIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEENAADFIKHSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDL 288          
The following BLAST results are available for this feature:
BLAST of CV998062 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
SUCA_ORYSJ1.209e-13185.25Probable succinyl-CoA ligase [GDP-forming] subunit... [more]
SUCA2_ARATH2.280e-13083.81Succinyl-CoA ligase [GDP-forming] subunit alpha-2,... [more]
SUCA1_ARATH2.521e-12983.81Succinyl-CoA ligase [GDP-forming] subunit alpha-1,... [more]
SUCA_DICDI6.914e-10366.67Succinyl-CoA ligase [GDP-forming] subunit alpha, m... [more]
SUCA_RAT4.955e-10166.31Succinyl-CoA ligase [GDP-forming] subunit alpha, m... [more]
SUCA_MOUSE4.194e-10065.59Succinyl-CoA ligase [GDP-forming] subunit alpha, m... [more]
SUCA_BOVIN1.220e-9966.31Succinyl-CoA ligase [GDP-forming] subunit alpha, m... [more]
SUCA_HUMAN7.910e-9965.59Succinyl-CoA ligase [GDP-forming] subunit alpha, m... [more]
SUCA_PIG1.349e-9865.59Succinyl-CoA ligase [GDP-forming] subunit alpha, m... [more]
SUCD_RICBR5.669e-9765.07Succinyl-CoA ligase [ADP-forming] subunit alpha OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_B-3_T3 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC27_C04_028, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998062 ID=CV998062|Name=CV998062|organism=Citrus sinensis|type=EST|length=953bp
TTTTTTTTACCAGAATCAAAATCAATTTCAAAATAAAAATGCTGAGAAGC
ACAATTTTTTGACATTGTGCAAAAAAGCTGTATAGAAATCTAGTGTTTCT
TTTATCAAAACTAACTTGCCAGGCCACGTTGCTTGAAAACCTCAAGCATA
GCAGAGCCAATTTTTGCGGGAGACTCTACCACTGTCACTCCGGCTTCCCT
GAGGGTCTTAATTTTGTCTTGAGCCGTGCCCTTCCCACCAGAGACGATAG
CTCCAGCATGACCCATACGGCGGCCAGGGGGAGCTGTTAGTCCAGCAATA
AAAGCAACAACGGGCTTCTCAGTCCCACTTTCCTTTATCAAGGCAGCGGC
ATCCTCTTCTGCAGTCCCACCGATCTCTCCTATTAGAATAATACCTTCTG
TCTGGGGATCAACTAGGAACTTTTCAAGGCAATCAACAAAGTTTGTCCCA
TTAAAAGGATCCCCACCTATACCTACACAGGTTGATTGTCCAAGGCCAAC
TACAGTTGTTTGAAAAACTGCTTCGTAGGTCAAGGTACCAGATCGAGAAA
CAATTCCAACCCGCCCAGGTTTGTGAATATACCCAGGCATAATGCCAATC
TTACATTCTCCAGGTTTGATGATACCAGGGCAGTTGGGACCAATCAGCCG
AGTTTTAGATTGCCTGTTTAGAGCAGCTTTCACTCGCACCATATCGTGTT
GAGGGATTCCTTCGGTGATACAGACGACAAGATCCAACTCAGCCTCCATA
GCCTCCATGATAGCAGCAGCAGCAAATGGCGGAGGAACATAAATGACAGA
AGCATTAGCCTTCGTTTCAGCCTTAGCTTCAGCAACCGAGTTGAATACAG
GAAGTCCCAAGTGCTCAGTCCCACCCTTCTTCGGCGTCACGCCACCCACC
ATTTTGGTGCCGTATTCGATGGCTTGTTNCGTATGGAACGTGCCGTTTTT
TCC
back to top