CV998058

Overview
NameCV998058
Unique NameCV998058
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length908
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9654 contig Csv1_Contig9654:440..1347. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PAL1_PRUAV (Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=PAL1 PE=2 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 3.263e-155
Identity = 279/304 (91.78%), Postives = 288/304 (94.74%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSKA GP+G+ + A EA +  G   GFFELQPKEGLALVNGTAVGSGLAS VLF+ N LALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYV  AKKLHE DPLQKPKQDRYALRTSPQWLGPQIEVIR++TKSIEREI+SVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIA+IGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA
Sbjct:  220 RPNSKAVGPDGQTLSAAEAFEFVGINSGFFELQPKEGLALVNGTAVGSGLASTVLFDTNILALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPKQDRYALRTSPQWLGPQIEVIRYSTKSIEREIDSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 523          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PALY_POPTR (Phenylalanine ammonia-lyase OS=Populus trichocarpa GN=PAL PE=2 SV=1)

HSP 1 Score: 545.043 bits (1403), Expect = 2.115e-154
Identity = 274/304 (90.13%), Postives = 287/304 (94.41%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSKATGP GE++DA EA K AG   GFFELQPKEGLALVNGTAVGSGLASMVLFE N LA+LSE+LSAIFAEVM GKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGS+Y+  AKKLHE DPLQKPKQDRYALRTSPQWLGPQIEVIRF+TKSIEREINSVNDNPLIDVSRNKA+HGGNFQGTPIGVSMDN RLAIA+IGKL+FAQFSELVNDFYNNGLPSNL+  RNPSLDYGFKGAEIAMASYCSELQ+LANPVT HVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMS+TFLVALCQA
Sbjct:  218 RPNSKATGPTGEVLDAAEAFKAAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPKQDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLIDVSRNKAIHGGNFQGTPIGVSMDNVRLAIASIGKLLFAQFSELVNDFYNNGLPSNLTASRNPSLDYGFKGAEIAMASYCSELQYLANPVTTHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQA 521          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PALY_CAMSI (Phenylalanine ammonia-lyase OS=Camellia sinensis GN=PAL PE=2 SV=1)

HSP 1 Score: 543.502 bits (1399), Expect = 6.154e-154
Identity = 276/304 (90.79%), Postives = 289/304 (95.07%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            R NSKA GP GEI+  +EA + AG   GFFELQPKEGLALVNGTAVGSGLASMVLFEAN LA+LSE+LSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYV  A+KLHE+DPLQKPKQDRYALRTSPQWLGP IEVIR +TKSIEREINSVNDNPLI+VSRNKALHGGNFQGTPIGVSMDNTRLA+A+IGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMA+YCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSST+LVALCQA
Sbjct:  217 RHNSKAVGPTGEILHPKEAFRLAGVEGGFFELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPLIEVIRSSTKSIEREINSVNDNPLINVSRNKALHGGNFQGTPIGVSMDNTRLAVASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQA 520          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PAL1_PETCR (Phenylalanine ammonia-lyase 1 OS=Petroselinum crispum GN=PAL1 PE=1 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 1.050e-153
Identity = 273/304 (89.80%), Postives = 288/304 (94.74%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSKA GP G I+  +EA K AG   GFFELQPKEGLALVNGTAVGSG+ASMVLFEAN LA+L+E++SAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGS+YV  A+KLHE+DPLQKPKQDRYALRTSPQWLGPQIEVIR +TK IEREINSVNDNPLIDVSRNKA+HGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKT+EAV+ILKLMS+TFLV LCQA
Sbjct:  219 RPNSKAVGPTGVILSPEEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRSSTKMIEREINSVNDNPLIDVSRNKAIHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQA 522          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PAL1_ARATH (Phenylalanine ammonia-lyase 1 OS=Arabidopsis thaliana GN=PAL1 PE=1 SV=3)

HSP 1 Score: 542.347 bits (1396), Expect = 1.371e-153
Identity = 270/304 (88.82%), Postives = 291/304 (95.72%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSKATGPNGE + A+EA K AG   GFF+LQPKEGLALVNGTAVGSG+ASMVLFE N L++L+EILSA+FAEVM GKPEFTDHLTH+LKHHPGQIEAAAIMEHILDGSSY+ +A+KLHE+DPLQKPKQDRYALRTSPQWLGPQIEVIR+ATKSIEREINSVNDNPLIDVSRNKA+HGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNL+  RNPSLDYGFKGAEIAMASYCSELQ+LANPVT+HVQSAEQHNQDVNSLGLISSRKT+EAVDILKLMS+TFLVA+CQA
Sbjct:  228 RPNSKATGPNGEALTAEEAFKLAGISSGFFDLQPKEGLALVNGTAVGSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAIMEHILDGSSYMKLAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRYATKSIEREINSVNDNPLIDVSRNKAIHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLTASRNPSLDYGFKGAEIAMASYCSELQYLANPVTSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQA 531          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PAL2_PETCR (Phenylalanine ammonia-lyase 2 OS=Petroselinum crispum GN=PAL2 PE=2 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 2.338e-153
Identity = 272/304 (89.47%), Postives = 288/304 (94.74%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSKA GP G I+  +EA K AG   GFFELQPKEGLALVNGTAVGSG+ASMVLFEAN LA+L+E++SAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGS+YV  A+KLHE+DPLQKPKQDRYALRTSPQWLGPQIEVIR +TK IEREINSVNDNPLIDVSRNKA+HGGNFQGTPIG+SMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKT+EAV+ILKLMS+TFLV LCQA
Sbjct:  219 RPNSKAVGPTGVILSPEEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRSSTKMIEREINSVNDNPLIDVSRNKAIHGGNFQGTPIGMSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQA 522          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PAL2_CICAR (Phenylalanine ammonia-lyase 2 OS=Cicer arietinum GN=PAL2 PE=2 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 5.209e-153
Identity = 273/304 (89.80%), Postives = 288/304 (94.74%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSK+ GPNG+I++A+EA + AG   GFFELQPKEGLALVNGTAVGSGLAS+ LFE N L +LSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGS YV  A+K+H+IDPLQKPKQDRYALRTSPQWLGPQIEVIR ATK IEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIA+IGKLMFAQFSELVNDFYNNGLPSNL+G RNPSLDYGFKGAEIAMASYCSELQ+LANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAV+ILKLMSSTFLVALCQA
Sbjct:  221 RPNSKSIGPNGQILNAKEAFQLAGIETGFFELQPKEGLALVNGTAVGSGLASLALFETNLLVVLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSYYVKAAQKVHDIDPLQKPKQDRYALRTSPQWLGPQIEVIRNATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLTGSRNPSLDYGFKGAEIAMASYCSELQYLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTFLVALCQA 524          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PALY_CITLI (Phenylalanine ammonia-lyase OS=Citrus limon GN=PAL6 PE=2 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 6.804e-153
Identity = 274/304 (90.13%), Postives = 285/304 (93.75%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSKA G NG++++  EA   AG   GFFELQPKEGLALVNGTAVGSGLA+ VLFEAN LA++SE+LSAIFAEVM GKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYV  A+KLHE DPLQKPKQDRYALRTSPQWLGPQIEVIR ATK IEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIA+IGKLMFAQFSELVNDFYNNGLPSNL+GGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGL SSRKTAEAVDILKLMSSTFLVALCQA
Sbjct:  223 RPNSKAVGSNGQVLNPTEAFNLAGVTSGFFELQPKEGLALVNGTAVGSGLAATVLFEANILAIMSEVLSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPKQDRYALRTSPQWLGPQIEVIRAATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLTGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLNSSRKTAEAVDILKLMSSTFLVALCQA 526          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PAL1_DAUCA (Phenylalanine ammonia-lyase 1 OS=Daucus carota GN=PAL1 PE=3 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 6.804e-153
Identity = 273/304 (89.80%), Postives = 285/304 (93.75%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSKA GP GE + A EA K AG   GFFELQPKEGLALVNGTAVGSG+ASMVLFE N LA+L+E++SAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYV  A+K HE+DPLQKPKQDRYALRTSPQWLGPQIEVIR +TK IEREINSVNDNPLIDVSRNKA+HGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFL NPVTNHVQSAEQHNQDVNSLGLISSRKTAEAV+ILKLMS+TFLV LCQA
Sbjct:  211 RPNSKAVGPTGENLTAAEAFKLAGVDGGFFELQPKEGLALVNGTAVGSGMASMVLFETNILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAEKQHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRSSTKMIEREINSVNDNPLIDVSRNKAIHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLGNPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSTTFLVGLCQA 514          
BLAST of CV998058 vs. ExPASy Swiss-Prot
Match: PAL2_PHAVU (Phenylalanine ammonia-lyase class 2 OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 8.886e-153
Identity = 271/304 (89.14%), Postives = 290/304 (95.39%), Query Frame = 2
Query:    2 RPNSKATGPNGEIIDAQEASKQAGFG--FFELQPKEGLALVNGTAVGSGLASMVLFEANNLALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVNVAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQA 907
            RPNSKA GP+GEI++A+EA + A  G  FFELQPKEGLALVNGTAVGSGLAS+VLFEAN LA+LSE++SAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSY+  AKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRF+TKSIEREINSVNDNPLI VSRNKALHGGNFQGTPIGVSMDNTRLAIA+IGKLMFAQFS+LVND+YNNGLPSNL+  RNPSLDYGFKGAEIAMASYCSELQ+LANPVT+HVQSAEQHNQDVNSLGLISSRKT EA++ILKLMSSTFLVALCQA
Sbjct:  215 RPNSKAVGPSGEILNAKEAFELANIGSEFFELQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEVISAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYIKAAKKLHEIDPLQKPKQDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLISVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFSDLVNDYYNNGLPSNLTASRNPSLDYGFKGAEIAMASYCSELQYLANPVTSHVQSAEQHNQDVNSLGLISSRKTNEALEILKLMSSTFLVALCQA 518          
The following BLAST results are available for this feature:
BLAST of CV998058 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 253
Match NameE-valueIdentityDescription
PAL1_PRUAV3.263e-15591.78Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=P... [more]
PALY_POPTR2.115e-15490.13Phenylalanine ammonia-lyase OS=Populus trichocarpa... [more]
PALY_CAMSI6.154e-15490.79Phenylalanine ammonia-lyase OS=Camellia sinensis G... [more]
PAL1_PETCR1.050e-15389.80Phenylalanine ammonia-lyase 1 OS=Petroselinum cris... [more]
PAL1_ARATH1.371e-15388.82Phenylalanine ammonia-lyase 1 OS=Arabidopsis thali... [more]
PAL2_PETCR2.338e-15389.47Phenylalanine ammonia-lyase 2 OS=Petroselinum cris... [more]
PAL2_CICAR5.209e-15389.80Phenylalanine ammonia-lyase 2 OS=Cicer arietinum G... [more]
PALY_CITLI6.804e-15390.13Phenylalanine ammonia-lyase OS=Citrus limon GN=PAL... [more]
PAL1_DAUCA6.804e-15389.80Phenylalanine ammonia-lyase 1 OS=Daucus carota GN=... [more]
PAL2_PHAVU8.886e-15389.14Phenylalanine ammonia-lyase class 2 OS=Phaseolus v... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_B-1_T3 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC25_A04_032, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998058 ID=CV998058|Name=CV998058|organism=Citrus sinensis|type=EST|length=908bp
CCGGCCCAATTCTAAGGCCACCGGGCCTAATGGAGAGATCATTGATGCCC
AGGAAGCCTCTAAACAAGCGGGTTTCGGGTTCTTTGAGTTGCAGCCTAAG
GAGGGTCTTGCTCTTGTCAATGGCACTGCTGTTGGTTCTGGCCTGGCTTC
TATGGTTCTGTTTGAGGCTAACAACCTTGCTCTGTTATCAGAAATTTTGT
CAGCTATTTTTGCTGAAGTCATGCAAGGCAAACCTGAGTTCACCGATCAC
TTGACACACAAATTGAAGCACCATCCTGGCCAAATTGAGGCTGCTGCTAT
AATGGAACATATCCTCGATGGCAGCTCTTATGTTAACGTGGCTAAGAAGT
TGCATGAGATTGATCCTCTGCAGAAGCCGAAACAGGATCGTTATGCCCTG
AGAACTTCACCACAATGGCTCGGCCCTCAGATCGAAGTGATTCGGTTTGC
AACCAAGTCTATTGAACGGGAGATCAACTCGGTGAATGACAATCCCCTGA
TCGACGTTTCAAGGAACAAGGCCTTACATGGTGGCAATTTTCAGGGGACC
CCAATTGGTGTCTCAATGGACAATACCCGTTTGGCTATTGCGGCAATAGG
GAAGCTCATGTTTGCCCAATTTTCTGAACTTGTCAACGATTTTTACAACA
ATGGATTGCCGTCAAATCTGTCTGGTGGCAGGAATCCTAGCCTGGATTAT
GGTTTCAAGGGCGCTGAAATTGCTATGGCTTCCTATTGTTCGGAGCTCCA
ATTTCTTGCCAATCCTGTTACTAACCACGTCCAAAGTGCTGAACAGCACA
ACCAAGATGTAAACTCCTTGGGATTGATCTCTTCCAGGAAGACTGCTGAA
GCAGTCGACATCCTGAAGCTCATGTCTTCCACATTCTTGGTAGCGCTTTG
CCAGGCTA
back to top