EY665454

Overview
NameEY665454
Unique NameEY665454
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length852
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY665454_ssr39 microsatellite EY665454_ssr39:39..50. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY665454 vs. ExPASy Swiss-Prot
Match: PHIP_HUMAN (PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.172e-16
Identity = 37/94 (39.36%), Postives = 57/94 (60.64%), Query Frame = 1
Query:  100 TPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGK 381
            T   V M+ W   +  V+ A+ +  + VWN+  G L+H L GH +  +VL+ HPF+PR+  SAG+DG  IVWD+  G+ IR Y    F +++G+
Sbjct:  423 TKMKVTMVAWDRHDNTVITAVNNMTLKVWNSYTGQLIHVLMGHEDEVFVLEPHPFDPRVLFSAGHDGNVIVWDLARGVKIRSY----FNMIEGQ 512          
BLAST of EY665454 vs. ExPASy Swiss-Prot
Match: PHIP_MOUSE (PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 4.143e-16
Identity = 36/94 (38.30%), Postives = 57/94 (60.64%), Query Frame = 1
Query:  100 TPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGK 381
            T   V M+ W   +  V+ A+ +  + VWN+  G L+H L GH +  +VL+ HPF+PR+  SAG+DG  IVWD+  G+ +R Y    F +++G+
Sbjct:  423 TKMKVTMVAWDRHDNTVITAVNNMTLKVWNSYTGQLIHVLMGHEDEVFVLEPHPFDPRVLFSAGHDGNVIVWDLARGVKVRSY----FNMIEGQ 512          
BLAST of EY665454 vs. ExPASy Swiss-Prot
Match: BRWD1_MOUSE (Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.056e-15
Identity = 36/90 (40.00%), Postives = 59/90 (65.56%), Query Frame = 1
Query:  112 VNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGK 381
            V MI W+ D+  V+ A+ D  + VW++  G L+H+L GH +  +VL+ HPF+ RI +SAG+DG   +WDI +GI ++ Y    F +++G+
Sbjct:  429 VTMIAWNQDDSTVVTAVNDHVLKVWSSYTGQLLHNLLGHADEVFVLETHPFDSRIMLSAGHDGSIFIWDITKGIKMKHY----FNMIEGQ 514          
BLAST of EY665454 vs. ExPASy Swiss-Prot
Match: BRWD1_HUMAN (Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=3)

HSP 1 Score: 82.0333 bits (201), Expect = 4.581e-15
Identity = 35/90 (38.89%), Postives = 58/90 (64.44%), Query Frame = 1
Query:  112 VNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGK 381
            V MI W+ ++  V+ A+ D  + VWN+  G L+H+L GH +  +VL+ HPF+ RI +SAG+DG   +WDI +G  ++ Y    F +++G+
Sbjct:  429 VTMIAWNQNDSIVVTAVNDHVLKVWNSYTGQLLHNLMGHADEVFVLETHPFDSRIMLSAGHDGSIFIWDITKGTKMKHY----FNMIEGQ 514          
BLAST of EY665454 vs. ExPASy Swiss-Prot
Match: BRWD3_MOUSE (Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.274e-14
Identity = 34/90 (37.78%), Postives = 56/90 (62.22%), Query Frame = 1
Query:  112 VNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGK 381
            V M+ W   +  V+ A+ +  + VWN+  G L+H+L+GH +  +VL+ HPF+ RI +SAG+DG   +WD+  G  IR Y    F +++G+
Sbjct:  426 VTMVAWDRYDTTVITAVNNFLLKVWNSVTGQLLHTLSGHDDEVFVLEAHPFDQRIILSAGHDGNIFIWDLDRGTKIRNY----FNMIEGQ 511          
BLAST of EY665454 vs. ExPASy Swiss-Prot
Match: BRWD3_HUMAN (Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.969e-14
Identity = 34/90 (37.78%), Postives = 56/90 (62.22%), Query Frame = 1
Query:  112 VNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGK 381
            V M+ W   +  V+ A+ +  + VWN+  G L+H+L+GH +  +VL+ HPF+ RI +SAG+DG   +WD+  G  IR Y    F +++G+
Sbjct:  426 VTMVAWDRYDTTVITAVNNFLLKVWNSITGQLLHTLSGHDDEVFVLEAHPFDQRIILSAGHDGNIFIWDLDRGTKIRNY----FNMIEGQ 511          
The following BLAST results are available for this feature:
BLAST of EY665454 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PHIP_HUMAN3.172e-1639.36PH-interacting protein OS=Homo sapiens GN=PHIP PE=... [more]
PHIP_MOUSE4.143e-1638.30PH-interacting protein OS=Mus musculus GN=Phip PE=... [more]
BRWD1_MOUSE2.056e-1540.00Bromodomain and WD repeat-containing protein 1 OS=... [more]
BRWD1_HUMAN4.581e-1538.89Bromodomain and WD repeat-containing protein 1 OS=... [more]
BRWD3_MOUSE2.274e-1437.78Bromodomain and WD repeat-containing protein 3 OS=... [more]
BRWD3_HUMAN2.969e-1437.78Bromodomain and WD repeat-containing protein 3 OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-C06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665454 ID=EY665454|Name=EY665454|organism=Citrus sinensis|type=EST|length=852bp
AAAGCTGCCCGCTGGACGCACGCTTACCATCTCAAAGTTCCTCCTCCTCC
TATGCCTCCTCAACCTCCACGAGGGGGGCCTCGTCAGAGAATTCTTCCAA
CTCCTCGTGGTGTAAATATGATTGTGTGGAGCCTAGACAACCGCTTTGTT
CTTGCTGCTATCATGGATTGCCGAATCTGTGTTTGGAATGCTGCAGATGG
TAGCTTAGTACATTCTTTGACTGGTCATACTGAATCTACGTATGTTTTGG
ATGTTCATCCTTTCAACCCCCGGATAGCTATGAGTGCTGGCTATGATGGA
AAAACTATAGTGTGGGATATTTGGGAAGGCATCCCAATCAGGATATATGA
AATTTCCCGTTTCAGGTTGGTCGACGGCAAGTTTTCACCGATAATATAGA
TTTAATCAGCACATTCGGTTTCATCCATCGGTTTCATCGATTAAGCTTCA
TGTATTCTCTAGTCACCTAGCAAAGCTGTTTATTTTTAGCTTTAATTACC
CCCAGCATACTACCAGGAGGCGCTCTTGGGATGGAGCTTCCTTATACTTT
CAGACAATGTTGGTCAATTATATATATTAAACACAGGCCAAGGGGAGTCT
TAAAAAGATGCCCAATACGAACAGGTTTTCCTTGGGGATTAATCGCCCCC
TTGTTCAAAAAACCTATGGAAATTGTACTTGATCAGGAAATTCAACTTGG
CTCTCCCCGGGGGGAATCTTGAGGGACCCTTTTTTGGAACTCCCCCTTGA
ATTCCTTCCCCGAGACCCTATTCAAACCTTTGACCCACAAAAAAAGGGGG
GGAATCTTTGGGGATTTTAGGGGGGCCCCTTTTTTCCTAAAATTTTGGGA
GG
back to top