EY665446

Overview
NameEY665446
Unique NameEY665446
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length843
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 1433_MESCR (14-3-3-like protein OS=Mesembryanthemum crystallinum GN=GBF PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.328e-32
Identity = 59/121 (48.76%), Postives = 76/121 (62.81%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFDYRVFLN*GVLEMDGN*PLPH---CDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EES G +  V     + E  G         CDGIL+L+ESHL+PSAS+ ES   YL M GD+H    +F+T   + + A N+L  YKS  +IA+ +LAPT PIRLGLALN S
Sbjct:   66 RIISSIEQKEESRGNEDHVST---IKEYRGKIETELSKICDGILNLLESHLIPSASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLLAYKSAQDIALAELAPTHPIRLGLALNFS 183          

HSP 2 Score: 60.8474 bits (146), Expect = 3.328e-32
Identity = 31/64 (48.44%), Postives = 42/64 (65.62%), Query Frame = 3
Query:    6 NESSPLWDVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            +ESS   +VYMAK+A+Q   Y +M EFM   AK T  ++L+ ++R  LS AY NVIG   ASW+
Sbjct:    3 SESSREENVYMAKLAEQAERYEEMVEFMEKVAKMTDTEELSVEERNLLSVAYKNVIGARRASWR 66          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 1433E_TOBAC (14-3-3-like protein E OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.751e-31
Identity = 58/121 (47.93%), Postives = 75/121 (61.98%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFDYRVFLN*GVLEMDGN*PLPH---CDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EES G +  V     + E  G         CDGIL+L+ESHL+P AS+ ES   YL M GD+H    +F+T   + + A N+L  YKS  +IA+ +LAPT PIRLGLALN S
Sbjct:   65 RIISSIEQKEESRGNEDHVS---SIKEYRGKIEAELSKICDGILNLLESHLIPVASTAESKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLLAYKSAQDIALAELAPTHPIRLGLALNFS 182          

HSP 2 Score: 59.6918 bits (143), Expect = 2.751e-31
Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 3
Query:    9 ESSPLWDVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            ES+   +VYMAK+A+Q   Y +M EFM   AK+   ++LT ++R  LS AY NVIG   ASW+
Sbjct:    3 ESTREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRASWR 65          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 14337_ARATH (14-3-3-like protein GF14 nu OS=Arabidopsis thaliana GN=GRF7 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.031e-30
Identity = 57/121 (47.11%), Postives = 77/121 (63.64%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFDYRVFL---N*GVLEMDGN*PLPHCDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EES G D  V +     G +E + +     CDGIL+L++SHL+P+AS  ES   YL M GD+H    +F+T   + + A ++L  YKS  +IA+  LAPT PIRLGLALN S
Sbjct:   64 RIISSIEQKEESRGNDDHVSIIKDYRGKIETELS---KICDGILNLLDSHLVPTASLAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQDIALADLAPTHPIRLGLALNFS 181          

HSP 2 Score: 59.3066 bits (142), Expect = 1.031e-30
Identity = 28/57 (49.12%), Postives = 38/57 (66.67%), Query Frame = 3
Query:   27 DVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            +VY+AK+A+Q   Y +M EFM   AK+   D+LT ++R  LS AY NVIG   ASW+
Sbjct:    8 NVYLAKLAEQAERYEEMVEFMEKVAKTVDTDELTVEERNLLSVAYKNVIGARRASWR 64          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 1433A_SOYBN (14-3-3-like protein A OS=Glycine max GN=GF14A PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.031e-30
Identity = 57/121 (47.11%), Postives = 76/121 (62.81%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFDYRVFLN*GVLEMDGN*PLPH---CDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EES G +  V +   + E  G         CDGIL+L+ES+L+PSA+S ES   YL M GD+H    +F+T   + + A ++L  YKS  +IA+  LAPT PIRLGLALN S
Sbjct:   65 RIISSIEQKEESRGNEDHVAI---IKEYRGKIEAELSKICDGILNLLESNLIPSAASPESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLLAYKSAQDIALADLAPTHPIRLGLALNFS 182          

HSP 2 Score: 60.8474 bits (146), Expect = 1.031e-30
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 3
Query:    6 NESSPLWDVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            ++SS   +VYMAK+AD+   Y +M EFM   AK+   ++LT ++R  LS AY NVIG   ASW+
Sbjct:    2 SDSSREENVYMAKLADEAERYEEMVEFMEKVAKTVEVEELTVEERNLLSVAYKNVIGARRASWR 65          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 1433B_HORVU (14-3-3-like protein B OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.342e-30
Identity = 55/121 (45.45%), Postives = 78/121 (64.46%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFDYRVFL---N*GVLEMDGN*PLPHCDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EES G + RV L     G +E++       CDGIL L++SHL+PS+++ ES   YL M GD++    +F++   + D A N++  YK+  EIA+ +L PT PIRLGLALN S
Sbjct:   68 RIISSIEQKEESRGNEDRVTLIKDYRGKIEVELT---KICDGILKLLDSHLVPSSTAPESKVFYLKMKGDYYRYLAEFKSGTERKDAAENTMVAYKAAQEIALAELPPTHPIRLGLALNFS 185          

HSP 2 Score: 60.8474 bits (146), Expect = 1.342e-30
Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 3
Query:    3 PNESSPLWDVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            P E S   +VYMAK+A+Q   Y +M EFM   AK+  +++LT ++R  LS AY NVIG   ASW+
Sbjct:    4 PAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWR 68          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 14332_MAIZE (14-3-3-like protein GF14-12 OS=Zea mays GN=GRF2 PE=2 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.748e-30
Identity = 56/121 (46.28%), Postives = 77/121 (63.64%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFDYRVFL---N*GVLEMDGN*PLPHCDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EE  G + RV L     G +E +       CDGIL L+ESHL+PS+++ ES   YL M GD++    +F+T   + D A N++  YK+  +IA+ +LAPT PIRLGLALN S
Sbjct:   67 RIISSIEQKEEGRGNEDRVTLIKDYRGKIETELT---KICDGILKLLESHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELAPTHPIRLGLALNFS 184          

HSP 2 Score: 59.3066 bits (142), Expect = 1.748e-30
Identity = 28/57 (49.12%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   27 DVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            +VYMAK+A+Q   Y +M EFM   AK+  +++LT ++R  LS AY NVIG   ASW+
Sbjct:   11 NVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWR 67          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 14332_ORYSJ (14-3-3-like protein GF14-B OS=Oryza sativa subsp. japonica GN=GF14B PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 2.276e-30
Identity = 56/121 (46.28%), Postives = 77/121 (63.64%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFDYRVFL---N*GVLEMDGN*PLPHCDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EES G + RV L     G +E +       CDGIL L+ESHL+PS+++ ES   YL M GD++    +F+T   + D A N++  YK+  +IA+ +L PT PIRLGLALN S
Sbjct:   68 RIISSIEQKEESRGNEDRVTLIKDYRGKIETELT---KICDGILKLLESHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELPPTHPIRLGLALNFS 185          

HSP 2 Score: 59.3066 bits (142), Expect = 2.276e-30
Identity = 28/57 (49.12%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   27 DVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            +VYMAK+A+Q   Y +M EFM   AK+  +++LT ++R  LS AY NVIG   ASW+
Sbjct:   12 NVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWR 68          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 14334_SOLLC (14-3-3 protein 4 OS=Solanum lycopersicum GN=TFT4 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.859e-30
Identity = 57/126 (45.24%), Postives = 78/126 (61.90%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFD--------YRVFLN*GVLEMDGN*PLPHCDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EES G +        YR  +   + ++        CDGILSL+ES+L+PSAS+ ES   +L M GD+H    +F+T   + + A N+L  YKS  +IA+ +LAPT PIRLGLALN S
Sbjct:   65 RIISSIEQKEESRGNEDHVNTIKEYRSKIEADLSKI--------CDGILSLLESNLIPSASTAESKVFHLKMKGDYHRYLAEFKTGTERKEAAENTLLAYKSAQDIALAELAPTHPIRLGLALNFS 182          

HSP 2 Score: 58.151 bits (139), Expect = 3.859e-30
Identity = 29/63 (46.03%), Postives = 41/63 (65.08%), Query Frame = 3
Query:    9 ESSPLWDVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            +SS   +VY+AK+A+Q   Y +M EFM   AK+   ++LT ++R  LS AY NVIG   ASW+
Sbjct:    3 DSSREENVYLAKLAEQAERYEEMIEFMEKVAKTADVEELTVEERNLLSVAYKNVIGARRASWR 65          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 14331_MAIZE (14-3-3-like protein GF14-6 OS=Zea mays GN=GRF1 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.859e-30
Identity = 55/121 (45.45%), Postives = 77/121 (63.64%), Query Frame = 1
Query:  196 KIISSIDQNEESMGFDYRVFL---N*GVLEMDGN*PLPHCDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q EE  G + RV L     G +E +       CDGIL L+E+HL+PS+++ ES   YL M GD++    +F+T   + D A N++  YK+  +IA+ +LAPT PIRLGLALN S
Sbjct:   67 RIISSIEQKEEGRGNEDRVTLIKDYRGKIETELT---KICDGILKLLETHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELAPTHPIRLGLALNFS 184          

HSP 2 Score: 59.3066 bits (142), Expect = 3.859e-30
Identity = 28/57 (49.12%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   27 DVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            +VYMAK+A+Q   Y +M EFM   AK+  +++LT ++R  LS AY NVIG   ASW+
Sbjct:   11 NVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWR 67          
BLAST of EY665446 vs. ExPASy Swiss-Prot
Match: 14335_ARATH (14-3-3-like protein GF14 upsilon OS=Arabidopsis thaliana GN=GRF5 PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 5.023e-30
Identity = 57/126 (45.24%), Postives = 77/126 (61.11%), Query Frame = 1
Query:  196 KIISSIDQNEESMGF--------DYRVFLN*GVLEMDGN*PLPHCDGILSLIESHLLPSASSVESNALYLPMDGDHHLDPFQFETAPFKTDTAPNSLPDYKSTHEIAIPQLAPTPPIRLGLALNVS 549
            +IISSI+Q E+S G         DYR     G +E + +     CDGIL+L+E+HL+P+AS  ES   YL M GD+H    +F+T   + + A ++L  YKS  +IA+  LAPT PIRLGLALN S
Sbjct:   66 RIISSIEQKEDSRGNSDHVSIIKDYR-----GKIETELS---KICDGILNLLEAHLIPAASLAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQDIALADLAPTHPIRLGLALNFS 183          

HSP 2 Score: 59.3066 bits (142), Expect = 5.023e-30
Identity = 29/64 (45.31%), Postives = 42/64 (65.62%), Query Frame = 3
Query:    6 NESSPLWDVYMAKMADQVVLYWDMAEFMHHFAKSTHADDLTWDDRKHLSFAYNNVIGVGMASWK 197
            ++SS   +VY+AK+A+Q   Y +M EFM   AK+   ++LT ++R  LS AY NVIG   ASW+
Sbjct:    3 SDSSREENVYLAKLAEQAERYEEMVEFMEKVAKTVETEELTVEERNLLSVAYKNVIGARRASWR 66          
The following BLAST results are available for this feature:
BLAST of EY665446 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 130
Match NameE-valueIdentityDescription
1433_MESCR3.328e-3248.7614-3-3-like protein OS=Mesembryanthemum crystallin... [more]
1433E_TOBAC2.751e-3147.9314-3-3-like protein E OS=Nicotiana tabacum PE=2 SV... [more]
14337_ARATH1.031e-3047.1114-3-3-like protein GF14 nu OS=Arabidopsis thalian... [more]
1433A_SOYBN1.031e-3047.1114-3-3-like protein A OS=Glycine max GN=GF14A PE=2... [more]
1433B_HORVU1.342e-3045.4514-3-3-like protein B OS=Hordeum vulgare PE=2 SV=1[more]
14332_MAIZE1.748e-3046.2814-3-3-like protein GF14-12 OS=Zea mays GN=GRF2 PE... [more]
14332_ORYSJ2.276e-3046.2814-3-3-like protein GF14-B OS=Oryza sativa subsp. ... [more]
14334_SOLLC3.859e-3045.2414-3-3 protein 4 OS=Solanum lycopersicum GN=TFT4 P... [more]
14331_MAIZE3.859e-3045.4514-3-3-like protein GF14-6 OS=Zea mays GN=GRF1 PE=... [more]
14335_ARATH5.023e-3045.2414-3-3-like protein GF14 upsilon OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-B09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665446 ID=EY665446|Name=EY665446|organism=Citrus sinensis|type=EST|length=843bp
CGCCTAATGAGTCTTCTCCCTTATGGGATGTCTACATGGCCAAGATGGCC
GACCAGGTTGTCCTTTATTGGGATATGGCTGAGTTCATGCACCATTTCGC
AAAATCAACCCATGCTGATGACCTAACCTGGGATGACCGGAAACATCTCT
CATTTGCTTACAACAATGTGATTGGGGTGGGAATGGCTTCATGGAAAGAT
CATCTCTTCTATTGATCAGAATGAGGAGAGCATGGGATTCGATTACCGTG
TCTTCTTGAATTAAGGAGTACTAGAGATGGATGGAAATTGACCTCTCCCT
CATTGTGATGGGATTCTTAGCCTCATTGAATCTCATCTCCTTCCCTCTGC
CTCTTCGGTTGAGTCTAATGCGCTCTACCTTCCTATGGATGGTGATCACC
ACTTGGATCCGTTTCAGTTTGAGACTGCACCTTTTAAGACCGATACTGCG
CCGAACTCTTTGCCGGACTACAAGTCAACTCACGAAATCGCTATACCTCA
ATTGGCCCCTACTCCCCCCATACGGCTGGGACTGGCACTCAATGTCTCCT
GTGTTCGACTATGACATCCGTTGATCCCCCGATTTTGGATGGCATCCTTG
CAAAGCAAGCTTTTGATTGACCGCCTTTTCTGAGCTTGATAACCTTGGGT
GAAAGATCATGACTAGGAATTTTCTTTGGTATATAACTTTCTCTCGAAAA
AAATCTAACCCTTTAGGACATCTTGTAATCACTGGTGATGGTGGGAAATA
AATTACCGGAAAACAAAAACTAATCCTGAATTCAGGGGAAAACCGGACAA
CTGCTTGAAGTATTGATTTCCCGGTCCTACGATTTGTTACCCG
back to top