EY659286

Overview
NameEY659286
Unique NameEY659286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig760 contig Csv1_Contig760:1020..1623. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNJH_CUCSA (DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 4.383e-44
Identity = 84/93 (90.32%), Postives = 90/93 (96.77%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 279
            LLIKS PGEVVKPDQFKAINDEGMPMYQRPFM+GKLYIHFSV+FP+SL+P+QCK LE VLPPRTSVQL+DMELDECEETTLHDVNIEEEMRRK
Sbjct:  297 LLIKSLPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPEQCKALEGVLPPRTSVQLSDMELDECEETTLHDVNIEEEMRRK 389          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNJH2_ALLPO (DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.405e-42
Identity = 79/93 (84.95%), Postives = 87/93 (93.55%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 279
            LLIKS PGEV+KPDQFK INDEGMPMYQRPFMRGKLYIHFSVDFP+SL+PDQCK LE+VLP R + +LTDME+DECEETT+HDVNIEEEMRRK
Sbjct:  299 LLIKSNPGEVIKPDQFKGINDEGMPMYQRPFMRGKLYIHFSVDFPDSLTPDQCKALESVLPSRNASRLTDMEIDECEETTMHDVNIEEEMRRK 391          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNJH1_ALLPO (DnaJ protein homolog 1 (Fragment) OS=Allium porrum GN=DNAJ1 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 2.659e-41
Identity = 79/93 (84.95%), Postives = 86/93 (92.47%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 279
            LLIKS PGEVVKPDQFKAINDEGMPMYQRPFMRGKLYI F VDFP+SL+PDQCK++E+VLP   S QLTDME+DECEETT+HDVNIEEEMRRK
Sbjct:  278 LLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIQFLVDFPDSLTPDQCKVIESVLPRSASSQLTDMEIDECEETTMHDVNIEEEMRRK 370          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNAJ3_ARATH (Chaperone protein dnaJ 3 OS=Arabidopsis thaliana GN=ATJ3 PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 2.752e-38
Identity = 73/93 (78.49%), Postives = 85/93 (91.40%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 279
            LLIKS PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHF+V+FP+SLSPDQ K LE VLP  ++ QL+DME+DECEETTLHDVNIE+EMRRK
Sbjct:  299 LLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRK 391          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNJH_ATRNU (DnaJ protein homolog ANJ1 OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.329e-37
Identity = 72/93 (77.42%), Postives = 84/93 (90.32%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 279
            LLIKS  GEVVKPDQFKAI DEGMP+YQRPFM+GK+YIHF+V+FP+SL+PDQ K LE +LPP+ S+ LT MELDECEETTLH+VNIEEEM+RK
Sbjct:  299 LLIKSNLGEVVKPDQFKAIEDEGMPIYQRPFMKGKMYIHFTVEFPDSLNPDQVKSLEAILPPKPSMSLTYMELDECEETTLHNVNIEEEMKRK 391          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNAJ2_ARATH (Chaperone protein dnaJ 2 OS=Arabidopsis thaliana GN=ATJ2 PE=1 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 3.042e-37
Identity = 70/93 (75.27%), Postives = 84/93 (90.32%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 279
            LLIKS+PGEVVKPD +KAI+DEGMP+YQRPFM+GKLYIHF+V+FPESLSPDQ K +E VLP  T   ++DME+D+CEETTLHDVNIE+EM+RK
Sbjct:  300 LLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRK 392          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNJA1_RAT (DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.122e-14
Identity = 40/94 (42.55%), Postives = 61/94 (64.89%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPES--LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRR 276
            ++I S PG++VK    K + +EGMP+Y+RP+ +G+L I F V+FPE+  LSPD+  +LE +LP R  V+    E DE ++  L D +  +E RR
Sbjct:  285 IVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVE----ETDEMDQVELVDFDPNQERRR 374          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNJA1_PONAB (DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.122e-14
Identity = 40/94 (42.55%), Postives = 61/94 (64.89%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPES--LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRR 276
            ++I S PG++VK    K + +EGMP+Y+RP+ +G+L I F V+FPE+  LSPD+  +LE +LP R  V+    E DE ++  L D +  +E RR
Sbjct:  284 IVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVE----ETDEMDQVELVDFDPNQERRR 373          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNJA1_MOUSE (DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.122e-14
Identity = 40/94 (42.55%), Postives = 61/94 (64.89%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPES--LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRR 276
            ++I S PG++VK    K + +EGMP+Y+RP+ +G+L I F V+FPE+  LSPD+  +LE +LP R  V+    E DE ++  L D +  +E RR
Sbjct:  285 IVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVE----ETDEMDQVELVDFDPNQERRR 374          
BLAST of EY659286 vs. ExPASy Swiss-Prot
Match: DNJA1_HUMAN (DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.122e-14
Identity = 40/94 (42.55%), Postives = 61/94 (64.89%), Query Frame = 1
Query:    1 LLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPES--LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRR 276
            ++I S PG++VK    K + +EGMP+Y+RP+ +G+L I F V+FPE+  LSPD+  +LE +LP R  V+    E DE ++  L D +  +E RR
Sbjct:  285 IVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVE----ETDEMDQVELVDFDPNQERRR 374          
The following BLAST results are available for this feature:
BLAST of EY659286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
DNJH_CUCSA4.383e-4490.32DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 P... [more]
DNJH2_ALLPO2.405e-4284.95DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE... [more]
DNJH1_ALLPO2.659e-4184.95DnaJ protein homolog 1 (Fragment) OS=Allium porrum... [more]
DNAJ3_ARATH2.752e-3878.49Chaperone protein dnaJ 3 OS=Arabidopsis thaliana G... [more]
DNJH_ATRNU2.329e-3777.42DnaJ protein homolog ANJ1 OS=Atriplex nummularia P... [more]
DNAJ2_ARATH3.042e-3775.27Chaperone protein dnaJ 2 OS=Arabidopsis thaliana G... [more]
DNJA1_RAT2.122e-1442.55DnaJ homolog subfamily A member 1 OS=Rattus norveg... [more]
DNJA1_PONAB2.122e-1442.55DnaJ homolog subfamily A member 1 OS=Pongo abelii ... [more]
DNJA1_MOUSE2.122e-1442.55DnaJ homolog subfamily A member 1 OS=Mus musculus ... [more]
DNJA1_HUMAN2.122e-1442.55DnaJ homolog subfamily A member 1 OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-D12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659286 ID=EY659286|Name=EY659286|organism=Citrus sinensis|type=EST|length=604bp
CTCCTCATCAAATCCCAGCCTGGGGAAGTAGTCAAGCCGGACCAATTCAA
GGCCATAAATGATGAAGGAATGCCTATGTATCAGAGGCCATTTATGAGGG
GCAAACTGTACATTCATTTCAGTGTTGACTTCCCTGAGTCACTGAGCCCA
GACCAGTGCAAGATGCTGGAGACCGTACTACCTCCAAGGACCTCAGTCCA
GCTCACCGATATGGAACTGGATGAGTGTGAAGAAACAACCCTGCATGATG
TGAACATTGAGGAGGAAATGCGAAGGAAGCAACAAGCAGCTCAGGAGGCA
TACGATGAAGATGACGATATGCAAGGTGGTGCCCAGAGAGTGCAGTGTGC
TCAGCAGTGATGATGTAGAAGAAAAGGGGTGGCCTGATTTAGTATTTTCA
TTGTTTGGGAGAAAAAGATTCTCAACATATTTATTTTCTGTTATAGGCTT
TAGAGGTTCTAGTTTTGGTTTGTCTGTCTTTATTCTTATGTTTTTCTGAT
AACTGACTATGTAATGGAATTCTAGCGTTTGCACCTTCAGACTCAATGCT
CATAATTAATATTTTTAGTGTTTACAATAAAAAAAAAAAAAAAAAAAAAA
AAAA
back to top