EY665405

Overview
NameEY665405
Unique NameEY665405
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1051
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 3.213e-92
Identity = 151/155 (97.42%), Postives = 153/155 (98.71%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIENFKVESPNVKYTD+EIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGI WATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLAD MA+
Sbjct:    1 MFIENFKVESPNVKYTDHEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGICWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMAR 155          

HSP 2 Score: 45.0542 bits (105), Expect = 3.213e-92
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RARVFDIDLQ QLRP+ME M P    + + DF+AA  G+ A   ++  +K++
Sbjct:  152 AMARARVFDIDLQKQLRPYMESMVPLP-GIYDPDFIAANQGSRANNVIKGTKKEQ 205          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.021e-87
Identity = 141/155 (90.97%), Postives = 150/155 (96.77%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVH+ +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLAD MA+
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHDEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMAR 155          

HSP 2 Score: 43.8986 bits (102), Expect = 1.021e-87
Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RA+VFDIDLQ QLRP+ME M P    + + DF+AA  G+ A   ++  +K++
Sbjct:  152 AMARAKVFDIDLQKQLRPYMESMVPLP-GIYDPDFIAANQGSRANNVIKGTKKEQ 205          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 2.957e-87
Identity = 141/155 (90.97%), Postives = 149/155 (96.13%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVHE +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDIS MNLAD MA+
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHEEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISGMNLADAMAR 155          

HSP 2 Score: 43.8986 bits (102), Expect = 2.957e-87
Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RA+VFDIDLQ QLRP+ME M P    + + DF+AA  G+ A   ++  +K++
Sbjct:  152 AMARAKVFDIDLQKQLRPYMESMVPLP-GIYDPDFIAANQGSRANNVIKGTKKEQ 205          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 5.032e-87
Identity = 140/155 (90.32%), Postives = 150/155 (96.77%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLAD MA+
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMAR 155          

HSP 2 Score: 42.743 bits (99), Expect = 5.032e-87
Identity = 25/55 (45.45%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RARV DIDLQ QLRP+ME M P    + + DF+AA  G+ A   ++  +K++
Sbjct:  152 AMARARVLDIDLQKQLRPYMEHMVPLP-GIYDPDFIAANQGSRANSVIKGTKKEQ 205          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 7.178e-86
Identity = 140/155 (90.32%), Postives = 150/155 (96.77%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIE+FKVESPNVKYT+ EIHSVY+YETTELVHE+RNGTYQWIVKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDIS+MNLAD M +
Sbjct:    1 MFIESFKVESPNVKYTEGEIHSVYNYETTELVHESRNGTYQWIVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISNMNLADAMGR 155          

HSP 2 Score: 40.817 bits (94), Expect = 7.178e-86
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RA+V DIDLQ QLRP+ME M P    + + DF+AA  G+ A   ++  +K++
Sbjct:  152 AMGRAKVLDIDLQKQLRPYMEHMVPLP-GIYDPDFIAANQGSRANNVIKGTKKEQ 205          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 1.221e-85
Identity = 138/155 (89.03%), Postives = 150/155 (96.77%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIE+FKVESPNVKYT+NEI+SVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNP+D+VFGGWDISDMNLAD MA+
Sbjct:    1 MFIESFKVESPNVKYTENEINSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPEDVVFGGWDISDMNLADAMAR 155          

HSP 2 Score: 42.3578 bits (98), Expect = 1.221e-85
Identity = 25/55 (45.45%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RARV DIDLQ QLRP+ME M P    + + DF+AA  G+ A   ++  +K++
Sbjct:  152 AMARARVLDIDLQKQLRPYMENMIPLP-GIYDPDFIAANQGSRANSVIKGTKKEQ 205          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 1.024e-84
Identity = 137/155 (88.39%), Postives = 149/155 (96.13%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIE+FKVESPNVKYT+NEIHSVYDY+TTELVHEN+NG +QW VKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLT GVIANREGISWATK+ VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNP++IVFGGWDISDMNLAD MA+
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYQTTELVHENKNGAFQWTVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTAGVIANREGISWATKEKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPEEIVFGGWDISDMNLADAMAR 155          

HSP 2 Score: 41.5874 bits (96), Expect = 1.024e-84
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RA+V DIDLQ Q+RPFME M P    + + DF+AA  G+ A   ++  +K++
Sbjct:  152 AMARAKVLDIDLQKQMRPFMEHMVPLP-GIFDPDFIAANQGSRANHVIKGTKKQQ 205          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.596e-82
Identity = 135/157 (85.99%), Postives = 146/157 (92.99%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRN--GTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIE+FKVESPNVKYT+NEI SVY+Y+TTELVHENR   G YQWIVKPKTV+Y FKTD  VPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD +QQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLAD M +
Sbjct:    1 MFIESFKVESPNVKYTENEIESVYNYDTTELVHENRKDAGGYQWIVKPKTVQYHFKTDTRVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKIQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMTR 157          

HSP 2 Score: 44.669 bits (104), Expect = 1.596e-82
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RARVFDIDLQ QLRP+ME M P    + + DF+AA  G+ A   ++  +K++
Sbjct:  154 AMTRARVFDIDLQKQLRPYMEHMVPLP-GIYDPDFIAANQGSRANNVIKGTKKEQ 207          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO1_BRANA (Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 289.271 bits (739), Expect = 2.082e-82
Identity = 134/155 (86.45%), Postives = 146/155 (94.19%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHEN NG YQWIVKPK VKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEE+YAPFKS++PMVNPDD+VFGGWDISDMNLAD M +
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENVNGAYQWIVKPKVVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEMYAPFKSLVPMVNPDDVVFGGWDISDMNLADAMGR 155          

HSP 2 Score: 39.2762 bits (90), Expect = 2.082e-82
Identity = 23/55 (41.82%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RA+V DIDLQ QLRP+ME + P    + + DF+AA  G+ A   ++  +K++
Sbjct:  152 AMGRAKVLDIDLQKQLRPYMENIVPLP-GIYDPDFIAANQGSRANNVIKGTKKEQ 205          
BLAST of EY665405 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 3.541e-82
Identity = 137/156 (87.82%), Postives = 148/156 (94.87%), Query Frame = 3
Query:   96 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENR-NGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADGMAQ 560
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHE   NGTYQWIVKPKTVKY+FKTD+ VPKLGVMLVG GGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLAD MA+
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHEKTVNGTYQWIVKPKTVKYDFKTDIRVPKLGVMLVGLGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMAR 156          

HSP 2 Score: 40.817 bits (94), Expect = 3.541e-82
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  550 AWPRARVFDIDLQNQLRPFMEIMGPTSWKL*NFDFLAAKSGAPAPPRVQRNQKKK 714
            A  RARV DIDLQ QLRP+ME + P    + + DF+AA  G+ A   ++  +K++
Sbjct:  153 AMARARVLDIDLQKQLRPYMENIVPLP-GIFDPDFIAANQGSRANHVIKGTKKEQ 206          
The following BLAST results are available for this feature:
BLAST of EY665405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_CITPA3.213e-9297.42Inositol-3-phosphate synthase OS=Citrus paradisi P... [more]
INO1_NICPA1.021e-8790.97Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_TOBAC2.957e-8790.97Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_WHEAT5.032e-8790.32Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_SESIN7.178e-8690.32Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO2_ARATH1.221e-8589.03Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO3_ARATH1.024e-8488.39Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO1_MESCR1.596e-8285.99Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]
INO1_BRANA2.082e-8286.45Inositol-3-phosphate synthase OS=Brassica napus PE... [more]
INO1_PHAVU3.541e-8287.82Inositol-3-phosphate synthase OS=Phaseolus vulgari... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-007-E10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665405 ID=EY665405|Name=EY665405|organism=Citrus sinensis|type=EST|length=1051bp
TTTTTTTTTTTTTTCTGCACTGTCGTACGGTCTGGATTCCGGGTCGACCC
ACGCGTCCGAGTTTTCAATTTTTTCTCTAAAATTTTCCTGGGAAAATGTT
TATCGAAAATTTCAAGGTTGAGAGCCCAAATGTGAAGTACACAGATAATG
AGATTCACTCTGTGTACGATTATGAAACCACTGAGCTTGTTCATGAGAAC
AGAAATGGCACTTATCAGTGGATTGTCAAGCCCAAAACTGTCAAATATGA
GTTCAAAACCGATGTTCATGTCCCTAAACTTGGGGTTATGCTTGTGGGTT
GGGGTGGAAACAACGGCTCAACTCTCACGGGTGGTGTTATCGCGAATCGA
GAGGGAATCTCCTGGGCCACAAAGGACACAGTGCAACAAGCCAATTATTT
TGGTTCACTTACCCAAGCATCAGCAATTAGAGTTGGGTCTTACAATGGAG
AGGAGATTTATGCTCCATTCAAGAGCATTCTCCCTATGGTGAACCCAGAT
GACATTGTGTTTGGAGGATGGGACATTAGTGACATGAACTTGGCTGATGG
CATGGCCCAGGGCTAGAGTGTTTGATATTGATCTTCAAAACCAACTTAGG
CCTTTCATGGAAATCATGGGTCCCACTTCCTGGAAACTATGAAACTTTGA
TTTCTTGGCTGCCAAATCAGGGGCCCCGGCCCCACCACGTGTTCAAAGGA
ACCAAAAAAAAAAAAATGGCACACAATCTCCAAAAATTTTTAAAGATTTT
AAGGGGAAAAAAACAGGGGGGAAAAGGGGGTTTTTGTATGGGGGGACCGG
CAAAACCCTGAAAAGGGAAAAGAAAATGGGTATTTTGGGGGGGTATAAAA
GGAACCCGGGGGGAAAAAACCTTTTTTGTTTTCCTGGGGGGAAAAAAAAA
AAAAAGGGGAAATTTTTCCCCCCCCCCCCCCCCTCTTGGAGGGGAGTTTT
TTGGTGTGGGGGCTTTTTACTAAAAAAAAATATACCACCCTTTTTTTTCC
CAAAATGAGAGAGGGGGACCCCCCCCCCCAACCAAAAAAAAACCTACCCT
T
back to top