EY665401

Overview
NameEY665401
Unique NameEY665401
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length984
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB26_ARATH (U-box domain-containing protein 26 OS=Arabidopsis thaliana GN=PUB26 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.640e-54
Identity = 112/200 (56.00%), Postives = 140/200 (70.00%), Query Frame = 3
Query:    6 MPGSLEPLDLSVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASSESNTY---XXXXXXXXXXXXXXXDSDKIRSLISSSNVRTIFSQVFFSNINVKTASPPKLAPKSLTLLGLVSPSLRRNAWEIARDPEK 596
            MPG+LEPLDL +QIPYHFRCPISL+LM DPVT+ TGQTYDR SI+SW+A GNTTCPVTR  L+DFTLIPNHTLRRLIQ+WCVANRS GV+RIPTPKQPA+P  VR+LL+QAS+ + T+                  DS+K R LI+  N R I  ++ F++I   T+   +L  +SL LL L+  +       +A DP +
Sbjct:    1 MPGNLEPLDLGIQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTRVALSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAITGTHVSVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADIET-TSLSSELVSESLALLVLLHMT-ETECEAVASDPSR 198          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB25_ARATH (U-box domain-containing protein 25 OS=Arabidopsis thaliana GN=PUB25 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 8.139e-54
Identity = 113/199 (56.78%), Postives = 138/199 (69.35%), Query Frame = 3
Query:    6 MPGSLEPLDLSVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGN-TTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASSESNTY---XXXXXXXXXXXXXXXDSDKIRSLISSSNVRTIFSQVFFSNINVKTASPPKLAPKSLTLLGLVSPSLRRNAWEIARDP 590
            MP ++EPLDL +QIPYHFRCPISLELM DPVTVCTGQTYDR SIESWV+ GN TTCPVTR+PL+DFTLIPNHTLRRLIQ+WCVANRS GV+RIPTPKQPA+P+ VR LL+QAS+ + T+                  DSDK R LI++ N   I  ++ FS       +  +L  +SL LL ++  +       I+ DP
Sbjct:    1 MPRNIEPLDLGIQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAITGTHVSVRSRAAALRRLRGFARDSDKNRVLIAAHNATEILIKILFSE-----TTSSELVSESLALLVMLPITEPNQFVSISSDP 194          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB22_ARATH (U-box domain-containing protein 22 OS=Arabidopsis thaliana GN=PUB22 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.915e-27
Identity = 57/107 (53.27%), Postives = 75/107 (70.09%), Query Frame = 3
Query:   27 LDLSVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGN-TTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASS 344
            +D  ++IP  F CPISL++M DPV V TG TYDR SIE W+ +G   +CPVT+  +T+  L PNHTLRRLIQ WC  N S+G++RIPTPK P   S +  L+ ++SS
Sbjct:    1 MDQEIEIPSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQVITETDLTPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKSEIEKLIKESSS 107          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB23_ARATH (U-box domain-containing protein 23 OS=Arabidopsis thaliana GN=PUB23 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.807e-27
Identity = 61/111 (54.95%), Postives = 75/111 (67.57%), Query Frame = 3
Query:   27 LDLSVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGN-TTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLL-NQASSESN 353
            +D  ++IP  F CPISLE+M DPV V TG TYDR SIE W+  G   +CPVT+  +TD  L PNHTLRRLIQ WC  N S+GV+RIPTP+ P   S +  L+ + ASS  N
Sbjct:    6 MDEEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITDADLTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHEN 116          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB21_ARATH (U-box domain-containing protein 21 OS=Arabidopsis thaliana GN=PUB21 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.468e-26
Identity = 61/146 (41.78%), Postives = 85/146 (58.22%), Query Frame = 3
Query:   39 VQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASSES--NTYXXXXXXXXXXXXXXXDSDKIRSLISSSNVRTIFSQVF 470
            + IP  F+CPIS++LM DPV + TG TYDR SIE+W+ +GN TCPVT + LT F  IPNHT+R++IQ WCV   S  +QRIPTP+ P  P  V  +  + SS +    Y               +S+K R  ++ ++V  +    F
Sbjct:   29 ITIPPEFQCPISIDLMKDPVIISTGITYDRVSIETWINSGNKTCPVTNTVLTTFDQIPNHTIRKMIQGWCVEKGSPLIQRIPTPRVPLMPCEVYEISRKLSSATRRGDYEKCGVIIEKIKKLGDESEKNRKCVNENSVGWVLCDCF 174          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB20_ARATH (U-box domain-containing protein 20 OS=Arabidopsis thaliana GN=PUB20 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.554e-23
Identity = 49/105 (46.67%), Postives = 68/105 (64.76%), Query Frame = 3
Query:   30 DLSVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASS 344
            ++ + IP  F+CPIS ELM DPV + +G TYDR +IE W  +G  TCPVT + LT    IPNHT+RR+IQ WC ++   G++RIPTP+ P     V  +  + S+
Sbjct:   28 EVEITIPSQFQCPISYELMKDPVIIASGITYDRENIEKWFESGYQTCPVTNTVLTSLEQIPNHTIRRMIQGWCGSSLGGGIERIPTPRVPVTSHQVSEICERLSA 132          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB24_ARATH (U-box domain-containing protein 24 OS=Arabidopsis thaliana GN=PUB24 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.713e-19
Identity = 49/88 (55.68%), Postives = 60/88 (68.18%), Query Frame = 3
Query:   39 VQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPL-TDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQP 299
            ++IP +F CPISLE+M DPVT  +G TYDR +I  W+     +CPVT+ PL  D  L PNH LRRLIQ WCV N + GV RI TP+ P
Sbjct:    8 IEIPNYFICPISLEIMKDPVTTVSGITYDRQNIVKWLEK-VPSCPVTKQPLPLDSDLTPNHMLRRLIQHWCVENETRGVVRISTPRVP 94          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: SL11_ORYSJ (Protein spotted leaf 11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 4.984e-19
Identity = 44/87 (50.57%), Postives = 55/87 (63.22%), Query Frame = 3
Query:   39 VQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQP 299
            + IP  FRCPISLELM DPV V TGQTY+R  IE W+A+G+ TCP T+  ++   L PN+ LR LI  WC  N     +R   P +P
Sbjct:  271 ITIPDEFRCPISLELMKDPVIVSTGQTYERACIEKWIASGHHTCPTTQQKMSTSALTPNYVLRSLISQWCETNGMEPPKRSTQPNKP 357          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: SL11_ORYSI (Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 4.984e-19
Identity = 44/87 (50.57%), Postives = 55/87 (63.22%), Query Frame = 3
Query:   39 VQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQP 299
            + IP  FRCPISLELM DPV V TGQTY+R  IE W+A+G+ TCP T+  ++   L PN+ LR LI  WC  N     +R   P +P
Sbjct:  271 ITIPDEFRCPISLELMKDPVIVSTGQTYERACIEKWIASGHHTCPTTQQKMSTSALTPNYVLRSLISQWCETNGMEPPKRSTQPNKP 357          
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB13_ARATH (U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.450e-18
Identity = 47/103 (45.63%), Postives = 62/103 (60.19%), Query Frame = 3
Query:   45 IPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVAN--------RSFGVQRIPTPKQPAEPSLVRTLL 329
            IP  FRCPISLE+M DPV V +GQTY+R  IE W+  G++TCP T+  LT  TL PN+ LR LI  WC AN         S   +++ +   PAE + +  L+
Sbjct:  256 IPDDFRCPISLEMMRDPVIVSSGQTYERTCIEKWIEGGHSTCPKTQQALTSTTLTPNYVLRSLIAQWCEANDIEPPKPPSSLRPRKVSSFSSPAEANKIEDLM 358          
The following BLAST results are available for this feature:
BLAST of EY665401 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
PUB26_ARATH1.640e-5456.00U-box domain-containing protein 26 OS=Arabidopsis ... [more]
PUB25_ARATH8.139e-5456.78U-box domain-containing protein 25 OS=Arabidopsis ... [more]
PUB22_ARATH2.915e-2753.27U-box domain-containing protein 22 OS=Arabidopsis ... [more]
PUB23_ARATH3.807e-2754.95U-box domain-containing protein 23 OS=Arabidopsis ... [more]
PUB21_ARATH2.468e-2641.78U-box domain-containing protein 21 OS=Arabidopsis ... [more]
PUB20_ARATH2.554e-2346.67U-box domain-containing protein 20 OS=Arabidopsis ... [more]
PUB24_ARATH1.713e-1955.68U-box domain-containing protein 24 OS=Arabidopsis ... [more]
SL11_ORYSJ4.984e-1950.57Protein spotted leaf 11 OS=Oryza sativa subsp. jap... [more]
SL11_ORYSI4.984e-1950.57Protein spotted leaf 11 OS=Oryza sativa subsp. ind... [more]
PUB13_ARATH1.450e-1845.63U-box domain-containing protein 13 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-007-E03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665401 ID=EY665401|Name=EY665401|organism=Citrus sinensis|type=EST|length=984bp
AAAACATGCCCGGAAGCTTAGAGCCGTTGGATTTGAGCGTTCAGATACCT
TATCATTTCCGCTGTCCGATCTCCCTCGAGCTGATGTGTGACCCCGTCAC
GGTCTGCACCGGTCAGACCTACGACCGGCCCAGCATCGAGTCGTGGGTCG
CCACCGGCAACACCACCTGCCCTGTCACCCGCTCCCCACTCACCGACTTC
ACTCTCATCCCCAACCACACCCTCCGCCGGCTCATCCAAGACTGGTGCGT
CGCGAACCGTTCTTTCGGCGTCCAACGAATCCCGACCCCGAAGCAACCGG
CCGAACCGAGTCTGGTCAGAACTCTGCTGAACCAGGCCTCCTCCGAGTCG
AACACTTACGGCTCCCGCTTGTCGGCCCTCCGTCGACTCAGAGGTCTCGC
CCGTGACTCTGACAAGATTCGTTCTCTCATTTCATCTTCCAACGTTCGAA
CGATATTTAGCCAGGTCTTTTTTTCGAATATAAATGTAAAAACGGCGTCC
CCTCCAAAGTTGGCGCCGAAGTCATTAACTTTGCTGGGCCTGGTTTCCCC
CTCACTGAGACGGAATGCATGGGAAATAGCCAGGGACCCGGAAAAAAAAT
TTCAAGCCTTGTCAAGTTTTATTTTTCCACTCCCTCAATACAAAATCCCG
GGTTAAATCCCCCGGCTTCGAAAAAAAAATTTGTTCTTTACCCGGGCATG
GAAATCTCAAAAAGTTTCGGGGCCCTAATTACTTTTATTTTTGGAAAAAA
TTTTTTCAAAAGGGGGGGGTGTCCCAATTTTTAAAAAAAAATTTTTTTTT
TTTCATATTCCCCCGGGGGGGCCCCAAAAAGGGGGGAGGGAAAAAAAGGG
GCCCTTTTTTCCCCCCCTTTTGTGTCCCTGGGTGGAAAAAAAAAAAAAAC
AAGCCGAAAAAAAAAAGGAGAGGTGGGGGGGGGGCGGCCCCAGAGAAAGG
GGGCGGGGAGGAAGAAAAACACAAGTGTGTGGGG
back to top