CV884651

Overview
NameCV884651
Unique NameCV884651
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length900
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Library UCRCS04-UCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7791 contig Csv1_Contig7791:253..1152. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 466.848 bits (1200), Expect = 7.202e-131
Identity = 229/236 (97.03%), Postives = 235/236 (99.58%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.502e-128
Identity = 223/236 (94.49%), Postives = 233/236 (98.73%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIG VPVGRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGIVPVGRVETGVVKPGMLVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.561e-128
Identity = 224/236 (94.92%), Postives = 233/236 (98.73%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VAS SKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 9.733e-128
Identity = 220/236 (93.22%), Postives = 234/236 (99.15%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGV+KNV+KKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 9.733e-128
Identity = 223/236 (94.49%), Postives = 231/236 (97.88%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLL+ALD I EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG VASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGIVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.271e-127
Identity = 222/236 (94.07%), Postives = 233/236 (98.73%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLL+ALD IN+ KRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLEALDQINDAKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 454.136 bits (1167), Expect = 4.831e-127
Identity = 221/236 (93.64%), Postives = 231/236 (97.88%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMI+RSTNLDWYKGPTLL+ALD I+EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+EAANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+ TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETF  YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  199 DNMIDRSTNLDWYKGPTLLEALDQISEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 452.981 bits (1164), Expect = 1.076e-126
Identity = 221/236 (93.64%), Postives = 231/236 (97.88%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLLDALD I+EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+EAANFT+QVII+NHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 452.981 bits (1164), Expect = 1.076e-126
Identity = 220/236 (93.22%), Postives = 231/236 (97.88%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNV FNVKNVAVKDLK G VASNSKDDPA++AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMLVTFAPTGLTTEVKSVEMHHEALTEALPGDNVRFNVKNVAVKDLKHGLVASNSKDDPAKDAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CV884651 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.405e-126
Identity = 222/236 (94.07%), Postives = 230/236 (97.46%), Query Frame = -3
Query:  191 DNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 898
            DNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELE  PKFLKNGDAG+VKMIPTKPMVVETF+ YPPLGRFAVRDMRQTVAVGVIK VEKKDP
Sbjct:  199 DNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEALPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQTVAVGVIKGVEKKDP 434          
The following BLAST results are available for this feature:
BLAST of CV884651 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ORYSJ7.202e-13197.03Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_VICFA1.502e-12894.49Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_MAIZE2.561e-12894.92Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_SOLLC9.733e-12893.22Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_MANES9.733e-12894.49Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_TOBAC1.271e-12794.07Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A2_DAUCA4.831e-12793.64Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]
EF1A_SOYBN1.076e-12693.64Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_PEA1.076e-12693.22Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_WHEAT1.405e-12694.07Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS04_2_008G04_T7 Ruby Orange Developing Flower cDNA Library UCRCS04-UCR Citrus sinensis cDNA clone UCRCS04_008_T7_G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV884651 ID=CV884651|Name=CV884651|organism=Citrus sinensis|type=EST|length=900bp
TTTATCAACTTACCAAAAAAAAACTCTGATATAAAACCAAATTCAGAGAA
TTAAAATGAAGTCCCGTAAAACAAACTAAAACACGACAAAAATAGCATAA
ACAGAGAAAATAAAAGCTAACTATAGCAGATAGATCCCAAAAAACTCCTC
ACTTCTTCTTGGCTGCAGACTTGGTGACCTTGGCACCTGTTGGATCCTTC
TTTTCAACATTCTTAATCACACCAACAGCAACAGTCTGACGCATGTCCCT
AACGGCAAAACGACCAAGAGGTGGGTAGTCAGAGAAGGTTTCAACAACCA
TGGGCTTGGTGGGAATCATCTTAACCATTCCAGCATCTCCATTCTTCAAG
AACTTGGGCTCCTTCTCAAGCTCCTTGCCTGATCGCCTATCAATCTTCGT
CACGAGCTCAGAAAACTTGACGGCAATGTGGGAGGTGTGGCAGTCAAGCA
CTGGGGCATATCCATTTCCAATCTGGCCAGGGTGGTTCATGATGATGACC
TGTGAGGTGAAGTTGGCAGCTTCCCTGGCTGGATCATCCTTCGAGTTGGA
AGCAACAAAACCACGCTTGAGATCCTTGACAGCAACGTTCTTCACGTTGA
AGCCAACATTGTCACCCGGAAGGGCCTCCTGCAGAGCTTCGTGGTGCATC
TCAACAGACTTAACCTCAGTTGTCAATCCAGAGGGGCCAAATGTCACCAC
CATACCAGGCTTGAGGACACCGGTCTCAACGCGACCCACTGGGACGGTTC
CAATGCCACCAATCTTGTACACGTCCTGGAGTGGCAGACGAAGGGGCTTG
TCTGAGGGCCTCTTCGGCTCATTGATATTGTCCAGAGCGTCCAGCAGGGT
TGGACCCTTGTACCAGTCAAGGTTGGTAGACCTCTCAATCATGTTGTCCC
back to top