CV884649

Overview
NameCV884649
Unique NameCV884649
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length797
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Library UCRCS04-UCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CV884649_ssr43 microsatellite CV884649_ssr43:43..64. BLAST: Citrus ESTs to Prunus persica proteins V1
CV884649_ssr33 microsatellite CV884649_ssr33:33..44. BLAST: Citrus ESTs to Prunus persica proteins V1
CV884649_ssr45 microsatellite CV884649_ssr45:45..64. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3357 contig Csv1_Contig3357:1..797. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA726_ARATH (Putative vesicle-associated membrane protein 726 OS=Arabidopsis thaliana GN=VAMP726 PE=2 SV=2)

HSP 1 Score: 363.999 bits (933), Expect = 5.412e-100
Identity = 177/216 (81.94%), Postives = 190/216 (87.96%), Query Frame = 2
Query:  149 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXXSVCHG 796
            MGQQSLIYSFVARGTVILAEYTEF GNFTS+A+QCLQKLP++NNKFTYNCDGHTFNYL +NGFTYCVV +ESAGRQIP+AFLERVKEDFNKRYGGGKA+TA ANSLNKEFGSKLKEHMQYC DHPEEISKL+KVKAQV+EVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR QGTKM+RK+W +NM                   SVCHG
Sbjct:    1 MGQQSLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLADNGFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQYCADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRKLWFENMKIKLIVFGIIVALILIIILSVCHG 216          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA722_ARATH (Vesicle-associated membrane protein 722 OS=Arabidopsis thaliana GN=VAMP722 PE=2 SV=2)

HSP 1 Score: 361.688 bits (927), Expect = 2.686e-99
Identity = 179/216 (82.87%), Postives = 190/216 (87.96%), Query Frame = 2
Query:  149 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXXSVCHG 796
            M QQSLIYSFVARGTVIL E+T+F GNFTSIA+QCLQKLP++NNKFTYNCDGHTFNYLVENGFTYCVVAV+SAGRQIP+AFLERVKEDFNKRYGGGKAATA ANSLNKEFGSKLKEHMQYC+DHP+EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR QGT+MRRKMW QNM                   S+C G
Sbjct:    1 MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRKMWFQNMKIKLIVLAIIIALILIIILSICGG 216          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA721_ARATH (Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana GN=VAMP721 PE=2 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 3.508e-99
Identity = 178/216 (82.41%), Postives = 191/216 (88.43%), Query Frame = 2
Query:  149 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXXSVCHG 796
            M QQSLIYSFVARGTVIL E+T+F GNFTSIA+QCLQKLP++NNKFTYNCDGHTFNYLVE+GFTYCVVAV+SAGRQIP++FLERVKEDFNKRYGGGKAATA ANSLNKEFGSKLKEHMQYC+DHP+EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR  GT+MRRKMW+QNM                   SVCHG
Sbjct:    1 MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDGFTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHG 216          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA725_ARATH (Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana GN=VAMP725 PE=2 SV=2)

HSP 1 Score: 360.918 bits (925), Expect = 4.581e-99
Identity = 180/222 (81.08%), Postives = 193/222 (86.94%), Query Frame = 2
Query:  134 VRVLR-MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXXSVCHG 796
            +RV R MGQQ+LIYSFVARGTVIL EYTEF GNFT++A+QCLQKLP++NNKFTYNCDGHTFNYLVENGFTYCVVAVES GRQIP+AFLERVKEDFNKRYGGGKA TA ANSLN+EFGSKLKEHMQYCVDHP+EISKLAKVKAQV+EVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR QGTK+RRKMW +NM                   SVC G
Sbjct:   60 LRVTRTMGQQNLIYSFVARGTVILVEYTEFKGNFTAVAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYCVDHPDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRKMWFENMKIKLIVLGIIITLILIIILSVCGG 281          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA724_ARATH (Vesicle-associated membrane protein 724 OS=Arabidopsis thaliana GN=VAMP724 PE=2 SV=2)

HSP 1 Score: 300.056 bits (767), Expect = 9.597e-81
Identity = 146/217 (67.28%), Postives = 173/217 (79.72%), Query Frame = 2
Query:  149 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNN-KFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXXSVCHG 796
            MGQ+S IYSFVARGT+ILAEYTEFTGNF SIA+QCLQKLP+++N KFTYNCD HTFN+LVE+G+ YCVVA +S  +QI IAFLERVK DF KRYGGGKA+TA+A SLNKEFG  +KEHM Y VDH EEI KL KVKAQVSEVK +M+ENI+K +DRGE + +L DKTENLRSQAQ++++QGT++RRK+W QNM                   SVCHG
Sbjct:    1 MGQESFIYSFVARGTMILAEYTEFTGNFPSIAAQCLQKLPSSSNSKFTYNCDHHTFNFLVEDGYAYCVVAKDSLSKQISIAFLERVKADFKKRYGGGKASTAIAKSLNKEFGPVMKEHMNYIVDHAEEIEKLIKVKAQVSEVKSIMLENIDKAIDRGENLTVLTDKTENLRSQAQEYKKQGTQVRRKLWYQNMKIKLVVLGILLLLVLIIWISVCHG 217          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA723_ARATH (Vesicle-associated membrane protein 723 OS=Arabidopsis thaliana GN=VAMP723 PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.342e-74
Identity = 144/216 (66.67%), Postives = 163/216 (75.46%), Query Frame = 2
Query:  149 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXXSVCHG 796
            M QQSL YSF+ARGTVIL E+T+F GNFTS+A+Q L+ LP++NNKFTYNCDGHTFN LVENGFTYCVVAV+SAGR+IP+AFLERVKEDF KRYGG KAAT  ANSLNKEFGS LKEHMQYC+DHP+EIS LAK KAQVSEVK +MMENIEKVL RG   E+L     +  SQ Q F  + T+M+RK W QNM                   SVC G
Sbjct:    1 MAQQSLFYSFIARGTVILVEFTDFKGNFTSVAAQYLENLPSSNNKFTYNCDGHTFNDLVENGFTYCVVAVDSAGREIPMAFLERVKEDFYKRYGGEKAATDQANSLNKEFGSNLKEHMQYCMDHPDEISNLAKAKAQVSEVKSLMMENIEKVLARGVICEML----GSSESQPQAFYIKRTQMKRKKWFQNMKIKLIVLAIIIALILIIILSVCGG 212          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA727_ARATH (Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana GN=VAMP727 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.698e-69
Identity = 127/211 (60.19%), Postives = 163/211 (77.25%), Query Frame = 2
Query:  149 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGG-------------------KAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNM 724
            M Q+ LIYSFVA+GTV+LAE+T ++GNF++IA QCLQKLP  ++K+TY+CDGHTFN+LV+NGF + VVA ES GR +P  FLERVKEDF KRY                          +VA +L++EFG  LKEHMQYC+ HPEE+SKL+K+KAQ++EVKG+MM+NIEKVLDRGEKIELLVDKTENL+ QA  F++QG ++RRKMW+Q++
Sbjct:    1 MSQKGLIYSFVAKGTVVLAEHTPYSGNFSTIAVQCLQKLPTNSSKYTYSCDGHTFNFLVDNGFVFLVVADESTGRSVPFVFLERVKEDFKKRYEASIKNDERHPLADEDEDDDLFGDRFSVAYNLDREFGPILKEHMQYCMSHPEEMSKLSKLKAQITEVKGIMMDNIEKVLDRGEKIELLVDKTENLQFQADSFQRQGRQLRRKMWLQSL 211          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA711_ARATH (Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=2 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 7.961e-35
Identity = 78/213 (36.62%), Postives = 129/213 (60.56%), Query Frame = 2
Query:  161 SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNK-FTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXXSVCHG 796
            +++Y+ VARGTV+L+E+T  + N ++IA Q L+K+P  N+   +Y+ D + F+    +G T   +A E+AGR+IP AFLE + + F + YG     TA+A ++N+EF   L + + Y  + P    ++ ++K ++++V+GVM+ENI+KVLDRGE++ELLVDKT N++     FR+Q  + R  +W +N                     +CHG
Sbjct:    2 AILYALVARGTVVLSEFTATSTNASTIAKQILEKVPGDNDSNVSYSQDRYVFHVKRTDGLTVLCMAEETAGRRIPFAFLEDIHQRFVRTYGRA-VHTALAYAMNEEFSRVLSQQIDYYSNDPNA-DRINRIKGEMNQVRGVMIENIDKVLDRGERLELLVDKTANMQGNTFRFRKQARRFRSNVWWRNCKLTVLLILLLLVIIYIAVAFLCHG 212          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA713_ARATH (Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.316e-34
Identity = 80/214 (37.38%), Postives = 130/214 (60.75%), Query Frame = 2
Query:  161 SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPA--TNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXXSVCHG 796
            ++I++ VARGTV+L+E++  + N +SI+ Q L+KLP   +++  +Y+ D + F+    +G T   +A E+AGR IP AFL+ + + F K YG     +A A S+N EF   L + M++  + P    +++++K ++S+V+ VM+ENI+KVLDRGE++ELLVDKTEN++     FR+Q  + R  MW +N+                    VCHG
Sbjct:    2 AIIFALVARGTVVLSEFSATSTNASSISKQILEKLPGNDSDSHMSYSQDRYIFHVKRTDGLTVLCMADETAGRNIPFAFLDDIHQRFVKTYGRA-IHSAQAYSMNDEFSRVLSQQMEFYSNDPNA-DRMSRIKGEMSQVRNVMIENIDKVLDRGERLELLVDKTENMQGNTFRFRKQARRYRTIMWWRNVKLTIALILVLALVVYIAMAFVCHG 213          
BLAST of CV884649 vs. ExPASy Swiss-Prot
Match: VA714_ARATH (Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.168e-32
Identity = 69/189 (36.51%), Postives = 124/189 (65.61%), Query Frame = 2
Query:  161 SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPA--TNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQN 721
            +++Y+ VARGTV+LAE++  TGN  ++  + L+KL    ++ +  ++ D + F+ L  +G T+  +A ++ GR++P ++LE +   F K YG   A  A A ++N EF   L + M++   +P  +  L +V+ +VSE++ VM+ENIEK+++RG++IELLVDKT  ++  +  FR+Q  ++RR +W++N
Sbjct:    2 AIVYAVVARGTVVLAEFSAVTGNTGAVVRRILEKLSPEISDERLCFSQDRYIFHILRSDGLTFLCMANDTFGRRVPFSYLEEIHMRFMKNYGK-VAHNAPAYAMNDEFSRVLHQQMEFFSSNPS-VDTLNRVRGEVSEIRSVMVENIEKIMERGDRIELLVDKTATMQDSSFHFRKQSKRLRRALWMKN 188          
The following BLAST results are available for this feature:
BLAST of CV884649 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
VA726_ARATH5.412e-10081.94Putative vesicle-associated membrane protein 726 O... [more]
VA722_ARATH2.686e-9982.87Vesicle-associated membrane protein 722 OS=Arabido... [more]
VA721_ARATH3.508e-9982.41Vesicle-associated membrane protein 721 OS=Arabido... [more]
VA725_ARATH4.581e-9981.08Vesicle-associated membrane protein 725 OS=Arabido... [more]
VA724_ARATH9.597e-8167.28Vesicle-associated membrane protein 724 OS=Arabido... [more]
VA723_ARATH1.342e-7466.67Vesicle-associated membrane protein 723 OS=Arabido... [more]
VA727_ARATH1.698e-6960.19Vesicle-associated membrane protein 727 OS=Arabido... [more]
VA711_ARATH7.961e-3536.62Vesicle-associated membrane protein 711 OS=Arabido... [more]
VA713_ARATH2.316e-3437.38Vesicle-associated membrane protein 713 OS=Arabido... [more]
VA714_ARATH2.168e-3236.51Vesicle-associated membrane protein 714 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS04_2_008G03_T3 Ruby Orange Developing Flower cDNA Library UCRCS04-UCR Citrus sinensis cDNA clone UCRCS04_008_T3_G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV884649 ID=CV884649|Name=CV884649|organism=Citrus sinensis|type=EST|length=797bp
GTTTCCCTCTCTCCGATCCCACGGTTTTCCTCTCCTTCCTTCCTCTCTCT
CTCTCTCTCTCTCTAATTTTTGTTTTTTCTGCTCCTCATTTTTTTTTGTC
AATTGAATCTTTCATCTCGAATTTGAATCTAGGGTTAGGGTTTTGAGGAT
GGGCCAACAGTCGTTGATCTATAGCTTCGTGGCTCGAGGCACGGTGATCC
TCGCCGAGTACACTGAGTTCACCGGTAATTTCACGAGCATCGCATCGCAA
TGTCTCCAGAAACTTCCCGCTACCAATAACAAGTTCACCTACAACTGCGA
TGGCCACACCTTCAATTACCTCGTTGAGAACGGCTTCACCTATTGTGTGG
TTGCTGTTGAATCTGCTGGCAGGCAAATTCCAATTGCCTTTCTGGAGCGA
GTTAAGGAGGATTTCAACAAGAGATATGGTGGAGGAAAAGCTGCAACGGC
TGTTGCAAATAGCCTGAACAAAGAGTTTGGGTCTAAACTAAAGGAGCACA
TGCAGTATTGTGTGGATCATCCTGAAGAGATCAGCAAGCTTGCCAAAGTC
AAAGCTCAGGTTTCTGAAGTCAAGGGGGTTATGATGGAAAATATTGAGAA
GGTTCTTGATCGTGGTGAGAAGATTGAGCTGCTGGTTGACAAAACTGAGA
ACCTTCGGTCACAGGCACAAGATTTCCGACAACAGGGGACGAAGATGAGA
AGGAAGATGTGGATCCAGAATATGAAGATTAAATTGATCGTTTTGGGTAT
CATCATCGCATTGATCCTTATCATCGTTCTGTCAGTTTGCCATGGCT
back to top