EH406478
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EH406478 vs. ExPASy Swiss-Prot
Match: DNJH_CUCSA (DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1) HSP 1 Score: 95.1301 bits (235), Expect = 1.395e-19 Identity = 44/50 (88.00%), Postives = 48/50 (96.00%), Query Frame = 1 Query: 1 FPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 150 FP+SL+P+QCK LE VLPPRTSVQL+DMELDECEETTLHDVNIEEEMRRK Sbjct: 340 FPDSLNPEQCKALEGVLPPRTSVQLSDMELDECEETTLHDVNIEEEMRRK 389
BLAST of EH406478 vs. ExPASy Swiss-Prot
Match: DNJH2_ALLPO (DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 2.227e-17 Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 1 Query: 1 FPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 150 FP+SL+PDQCK LE+VLP R + +LTDME+DECEETT+HDVNIEEEMRRK Sbjct: 342 FPDSLTPDQCKALESVLPSRNASRLTDMEIDECEETTMHDVNIEEEMRRK 391
BLAST of EH406478 vs. ExPASy Swiss-Prot
Match: DNJH1_ALLPO (DnaJ protein homolog 1 (Fragment) OS=Allium porrum GN=DNAJ1 PE=2 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 2.227e-17 Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 1 Query: 1 FPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 150 FP+SL+PDQCK++E+VLP S QLTDME+DECEETT+HDVNIEEEMRRK Sbjct: 321 FPDSLTPDQCKVIESVLPRSASSQLTDMEIDECEETTMHDVNIEEEMRRK 370
BLAST of EH406478 vs. ExPASy Swiss-Prot
Match: DNAJ3_ARATH (Chaperone protein dnaJ 3 OS=Arabidopsis thaliana GN=ATJ3 PE=1 SV=2) HSP 1 Score: 82.8037 bits (203), Expect = 7.165e-16 Identity = 38/50 (76.00%), Postives = 44/50 (88.00%), Query Frame = 1 Query: 1 FPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 150 FP+SLSPDQ K LE VLP ++ QL+DME+DECEETTLHDVNIE+EMRRK Sbjct: 342 FPDSLSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRK 391
BLAST of EH406478 vs. ExPASy Swiss-Prot
Match: DNJH_ATRNU (DnaJ protein homolog ANJ1 OS=Atriplex nummularia PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 1.596e-15 Identity = 37/50 (74.00%), Postives = 44/50 (88.00%), Query Frame = 1 Query: 1 FPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 150 FP+SL+PDQ K LE +LPP+ S+ LT MELDECEETTLH+VNIEEEM+RK Sbjct: 342 FPDSLNPDQVKSLEAILPPKPSMSLTYMELDECEETTLHNVNIEEEMKRK 391
BLAST of EH406478 vs. ExPASy Swiss-Prot
Match: DNAJ2_ARATH (Chaperone protein dnaJ 2 OS=Arabidopsis thaliana GN=ATJ2 PE=1 SV=2) HSP 1 Score: 78.9518 bits (193), Expect = 1.035e-14 Identity = 35/50 (70.00%), Postives = 42/50 (84.00%), Query Frame = 1 Query: 1 FPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 150 FPESLSPDQ K +E VLP T ++DME+D+CEETTLHDVNIE+EM+RK Sbjct: 343 FPESLSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRK 392 The following BLAST results are available for this feature:
BLAST of EH406478 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EH406478 ID=EH406478; Name=EH406478; organism=Citrus sinensis; type=EST; length=448bpback to top |