EY665185

Overview
NameEY665185
Unique NameEY665185
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length535
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665185 vs. ExPASy Swiss-Prot
Match: SYEC_YEAST (Glutamyl-tRNA synthetase, cytoplasmic OS=Saccharomyces cerevisiae GN=GUS1 PE=1 SV=3)

HSP 1 Score: 114.39 bits (285), Expect = 3.522e-25
Identity = 58/111 (52.25%), Postives = 74/111 (66.67%), Query Frame = 2
Query:   23 GSTPRPLHLEGSVKNTKLKLTWLPETNELVNLTLVGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSSKPVVLFAIPDGR 355
            GS    L+LEG  K TK KLTWL +T ++V + LV FD+LITK +LEE E F D L P T F T AI D N++++K G+I+Q ERKGY+R D    +  KP V F IPDG+
Sbjct:  590 GSMVAKLNLEGDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVKDMKIGDIIQFERKGYYRLDA-LPKDGKPYVFFTIPDGK 699          
BLAST of EY665185 vs. ExPASy Swiss-Prot
Match: SYEC_SCHPO (Probable glutamyl-tRNA synthetase, cytoplasmic OS=Schizosaccharomyces pombe GN=SPAC17A5.15c PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.982e-24
Identity = 54/105 (51.43%), Postives = 71/105 (67.62%), Query Frame = 2
Query:   41 LHLEGSVKNTKLKLTWLPETNELVNLTLVGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSSKPVVLFAIPDGR 355
            LHL+G  K T+ K+TWL +T +   + LV FDYLITK KLEEGE++ D L P T F +    D  ++NLK+G+I+Q+ERKGY+  DVPF       VLF IPDG+
Sbjct:  605 LHLDGDFKKTEKKVTWLADTEDKTPVDLVDFDYLITKDKLEEGENYKDFLTPQTEFHSPVFADVGIKNLKKGDIIQVERKGYYIVDVPF--DGTQAVLFNIPDGK 707          
BLAST of EY665185 vs. ExPASy Swiss-Prot
Match: SYEC_DICDI (Probable glutamyl-tRNA synthetase, cytoplasmic OS=Dictyostelium discoideum GN=gluS PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 9.615e-15
Identity = 44/105 (41.90%), Postives = 60/105 (57.14%), Query Frame = 2
Query:   41 LHLEGSVKNTKLKLTWLP-ETNELVNLTLVGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSSKPVVLFAIPDG 352
            LHLEG VK T  KL+WL  +  + V + L  +DY+ITK KLE+G+D     N  ++FE  A  D N+  LK  + +Q ER+G+F  D       KP +L  IP G
Sbjct:  624 LHLEGDVKKTDKKLSWLSSDCADTVTVVLQDYDYIITKPKLEDGDDLDTFTNKNSKFEIEAFTDENILTLKLNDKIQFERRGFFNVD-QVGDGVKPYILIYIPSG 727          
BLAST of EY665185 vs. ExPASy Swiss-Prot
Match: SYEP_HUMAN (Bifunctional aminoacyl-tRNA synthetase OS=Homo sapiens GN=EPRS PE=1 SV=5)

HSP 1 Score: 75.485 bits (184), Expect = 1.813e-13
Identity = 42/112 (37.50%), Postives = 65/112 (58.04%), Query Frame = 2
Query:   41 LHLEGSVKNTKLKLTWLPETNELVNLTL--VGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSS------KPVVLFAIPDG 352
            L+LE        K+TWL ET   + + +  V +++LITK  L + EDF   +N  ++ E   +GD  +++LK+G+I+QL+R+G+F CD P+   S       P VL  IPDG
Sbjct:  594 LNLENKDYKKTTKVTWLAETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDG 705          
BLAST of EY665185 vs. ExPASy Swiss-Prot
Match: SYEP_MOUSE (Bifunctional aminoacyl-tRNA synthetase OS=Mus musculus GN=Eprs PE=2 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 2.368e-13
Identity = 40/112 (35.71%), Postives = 65/112 (58.04%), Query Frame = 2
Query:   41 LHLEGSVKNTKLKLTWLPETNELVNL--TLVGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSS------KPVVLFAIPDG 352
            L+LE        K+TWL E+   +++    V +++LITK  L + EDF   +N  ++ E   +GD  +++LK+G+I+QL+R+G+F CD P+   S       P +L  IPDG
Sbjct:  594 LNLENKDYKKTTKITWLAESTHALSIPAVCVTYEHLITKPVLGKDEDFKQYINKDSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCREAPCILIYIPDG 705          
BLAST of EY665185 vs. ExPASy Swiss-Prot
Match: SYEP_DROME (Bifunctional aminoacyl-tRNA synthetase OS=Drosophila melanogaster GN=Aats-glupro PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 8.999e-13
Identity = 44/123 (35.77%), Postives = 65/123 (52.85%), Query Frame = 2
Query:   26 STPRPLHLEGSVKNTKLKLTWLP---ETNELVNLTLVGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVP------FTRSSKPVVLFAIPDGRQQAV 367
            S    L+LE       LKLTWL    + +       V FD +I+K  L + EDF   +   TR E   +GD  ++  K+G+I+QL+R+G+F+ DV       +T    P+VLF+IPDG  + V
Sbjct:  595 SVDAALNLENKDFKKTLKLTWLAVEDDPSAYPPTFCVYFDNIISKAVLGKDEDFKQFIGHKTRDEVPMLGDPELKKCKKGDIIQLQRRGFFKVDVAYAPPSGYTNVPSPIVLFSIPDGHTKDV 717          
The following BLAST results are available for this feature:
BLAST of EY665185 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
SYEC_YEAST3.522e-2552.25Glutamyl-tRNA synthetase, cytoplasmic OS=Saccharom... [more]
SYEC_SCHPO2.982e-2451.43Probable glutamyl-tRNA synthetase, cytoplasmic OS=... [more]
SYEC_DICDI9.615e-1541.90Probable glutamyl-tRNA synthetase, cytoplasmic OS=... [more]
SYEP_HUMAN1.813e-1337.50Bifunctional aminoacyl-tRNA synthetase OS=Homo sap... [more]
SYEP_MOUSE2.368e-1335.71Bifunctional aminoacyl-tRNA synthetase OS=Mus musc... [more]
SYEP_DROME8.999e-1335.77Bifunctional aminoacyl-tRNA synthetase OS=Drosophi... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665185 ID=EY665185|Name=EY665185|organism=Citrus sinensis|type=EST|length=535bp
CGGGTCCGGGGTCCGGATTCCCGGGTCGACCCCGCGTCCGTTGCATCTTG
AAGGATCTGTCAAGAACACAAAGTTGAAGCTCACATGGCTGCCTGAGACA
AATGAGTTAGTTAACCTCACATTGGTTGGCTTTGACTATCTAATCACAAA
GAAGAAGCTGGAAGAAGGAGAGGACTTCCTTGATGTGCTCAACCCCTGTA
CAAGATTTGAGACTGCAGCTATTGGAGATTCAAACATGCGGAATCTGAAG
CGGGGAGAGATTTTGCAACTGGAGAGGAAGGGCTACTTCAGATGCGATGT
TCCTTTTACCAGATCTTCAAAGCCAGTGGTTCTCTTTGCAATCCCAGATG
GGCGCCAGCAAGCAGTCTTTAAGTAAAACCTTTATACTTATTAAGGTGTC
CACTGTCTTTATGAGTTTATTTAGCTGTGATTGGGAAACTTTATTTCTTA
CATTTCCTTTCGCATATTTTTGAACCACTGTTGACTTAATTAATTGGATT
ACTGTTTTTTTAAAAAAAAAAAAAAAAAAAAAAAA
back to top