EY665182

Overview
NameEY665182
Unique NameEY665182
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1045
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: RH27_ORYSJ (DEAD-box ATP-dependent RNA helicase 27 OS=Oryza sativa subsp. japonica GN=Os03g0802700 PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 5.028e-57
Identity = 119/193 (61.66%), Postives = 147/193 (76.17%), Query Frame = 1
Query:    1 EDLARLSFQ------TTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLDSRKNLHFPSIF*RAGKNPLVKKIMN 561
            ++ A+LSF+      + PVY+ VDD  T  T EGLQQGYCV+ SA+RF++LY+FLK+  +KKVMVFFSSCNSVKFH+ELL ++Q++C DIHGKQKQQKRTTTFF+FCKAEKGILLCT+VAARGLDIP VD+IVQYDPPDEPK+ Y      TA  +KG KG A LFL   + L F  I+ +A K  L + + N
Sbjct:  289 KEFAKLSFEKNEESTSKPVYVGVDDAETNATVEGLQQGYCVIDSARRFLVLYAFLKKKQNKKVMVFFSSCNSVKFHAELLNFLQIECSDIHGKQKQQKRTTTFFNFCKAEKGILLCTNVAARGLDIPDVDFIVQYDPPDEPKD-YIHRVGRTARGEKG-KGEALLFL-LPQELKF-LIYLKAAKISLTELVFN 477          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: RH51_ARATH (DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 3.051e-54
Identity = 118/199 (59.30%), Postives = 146/199 (73.37%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLDSRKNLHFPSIF*RAGKNPLVKKIMNFEPKKTGSKVQS 597
            +DLAR+S  T+PV++DVDDGR KVTNEGL+QGYCVVPS +R ILL SFLK+NL+KK+MVFFS+C SV+FH+E+++   VD  DIHG   Q +RT TFFDF KA+KGILLCTDVAARGLDIP+VDWI+QYDPPD+P E      VG     +GAKG A L L   + L F   + +A K P+  K + F  K+  S VQS
Sbjct:  282 KDLARVSL-TSPVHVDVDDGRRKVTNEGLEQGYCVVPSKQRLILLISFLKKNLNKKIMVFFSTCKSVQFHTEIMKISDVDVSDIHGGMDQNRRTKTFFDFMKAKKGILLCTDVAARGLDIPSVDWIIQYDPPDKPTEYIHR--VGRTARGEGAKGKALLVL-IPEELQFIR-YLKAAKVPV--KELEFNEKRL-SNVQS 472          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX18_DICDI (Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 1.085e-51
Identity = 98/161 (60.87%), Postives = 124/161 (77.02%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            +D+A++S   +PVY+ VDD R   T EGL+QGY V PS +RF+LLY+FLK+NLSKK++VF SSCN+VK+ +ELL YI +   ++HG+QKQQKRT TF++F  AEKGIL+CTDVAARGLDIP+VDWI+QYDPPD+PKE      VG      G KG A LFL
Sbjct:  312 DDIAKVSLNNSPVYVGVDDEREISTVEGLEQGYVVCPSERRFLLLYTFLKKNLSKKIIVFLSSCNAVKYTAELLNYIDIPVLELHGRQKQQKRTNTFYEFVNAEKGILICTDVAARGLDIPSVDWIIQYDPPDDPKEYIHR--VGRTARGVGKKGRALLFL 470          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_SCHPO (ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe GN=has1 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.851e-51
Identity = 103/161 (63.98%), Postives = 125/161 (77.64%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            EDLAR+S +  P+Y++VD G+   T EGL+QGY VV S KRF+LL+SFLKRNL KKV+VF SSC SVK+ +ELL YI +   D+HGKQKQQ+RT TFF+FC AEKGILLCT+VAARGLDIPAVDWIVQYDPPD+P++ Y      TA   KG  G + +FL
Sbjct:  283 EDLARISLKPGPLYVNVDSGKPTSTVEGLEQGYVVVDSDKRFLLLFSFLKRNLKKKVIVFMSSCASVKYMAELLNYIDLPVLDLHGKQKQQRRTNTFFEFCNAEKGILLCTNVAARGLDIPAVDWIVQYDPPDDPRD-YIHRVGRTARGTKGT-GKSLMFL 441          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX18_MOUSE (ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 4.123e-51
Identity = 95/137 (69.34%), Postives = 110/137 (80.29%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE 411
            EDLAR+S +  P+Y+ VDD +   T +GL+QGY V PS KRF+LL++FLK+N  KKVMVFFSSC SVK+H ELL YI +    IHGKQKQ KRTTTFF FC A+ GILLCTDVAARGLDIP VDWIVQYDPPD+PKE
Sbjct:  362 EDLARISLKKEPLYVGVDDDKEVATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKVMVFFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQYDPPDDPKE 498          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_NEUCR (ATP-dependent RNA helicase has-1 OS=Neurospora crassa GN=has-1 PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 9.185e-51
Identity = 115/230 (50.00%), Postives = 149/230 (64.78%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLDSRKNLHFPSIF*RAGKNPLVKKIMNFEPKKTGSKVQSPSGEKIGLANTYLILKPTPPKNGVTHFLFPY 690
            EDLAR+S +  P+Y++VD+ +   T EGL QGY VV + KRF+LL+SFLK+   KKV+VFFSSCNSVK++SELL+YI +   D+HGKQKQQKRT TFF+FC A++G L+CTDVAARGLDIPAVDWIVQ+DPPD+P++      VG        KG + LFL   +      +  +A K P+V+      PK     VQS   + IG  N YL       K+G   +L  Y
Sbjct:  300 EDLARISLRPGPLYVNVDEEKQFSTVEGLDQGYVVVDADKRFLLLFSFLKKMQKKKVIVFFSSCNSVKYYSELLQYIDLQVLDLHGKQKQQKRTNTFFEFCNAKQGTLICTDVAARGLDIPAVDWIVQFDPPDDPRDYIHR--VGRTARGNNTKGRSLLFLQPNELGFLAHL--KAAKVPVVEYDF---PKSKILNVQSQLEKLIG-QNYYL---NQSAKDGYRSYLHAY 518          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_COCIM (ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis GN=HAS1 PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 9.185e-51
Identity = 96/161 (59.63%), Postives = 122/161 (75.78%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            EDLAR+S +  P+YI+VD  +   T EGL+QGY +  S KRF+LL+SFLKRNL KK++VFFSSCN VK+H+ELL YI +   D+HGKQKQQKRT TFF+FC A++G L+CTDVAARGLDIPAVDWI+Q+DPPD+P++      VG        KG + +FL
Sbjct:  318 EDLARISLRPGPLYINVDHRKEHSTVEGLEQGYVICDSDKRFLLLFSFLKRNLKKKIIVFFSSCNCVKYHAELLNYIDLPVLDLHGKQKQQKRTNTFFEFCNAKQGTLICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHR--VGRTARGANGKGRSLMFL 476          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX18_HUMAN (ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2)

HSP 1 Score: 200.29 bits (508), Expect = 1.567e-50
Identity = 93/137 (67.88%), Postives = 109/137 (79.56%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE 411
            EDLAR+S +  P+Y+ VDD +   T +GL+QGY V PS KRF+LL++FLK+N  KK+MVFFSSC SVK+H ELL YI +    IHGKQKQ KRTTTFF FC A+ G LLCTDVAARGLDIP VDWIVQYDPPD+PKE
Sbjct:  372 EDLARISLKKEPLYVGVDDDKANATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGTLLCTDVAARGLDIPEVDWIVQYDPPDDPKE 508          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_NEOFI (ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 2.046e-50
Identity = 95/161 (59.01%), Postives = 123/161 (76.40%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            EDLAR+S +  P+YI+VD  +   T EGL+QGY +  + KRF+LL+SFLKRNL KK++VFFSSCN VK+H+ELL YI +   ++HGKQKQQKRT TFF+FC A++G L+CTDVAARGLDIPAVDWI+Q+DPPD+P++      VG       AKG + +FL
Sbjct:  334 EDLARISLRPGPLYINVDHRKEHSTVEGLEQGYVICEADKRFLLLFSFLKRNLKKKIIVFFSSCNCVKYHAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAKQGTLICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHR--VGRTARGANAKGRSLMFL 492          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_ASPFU (ATP-dependent RNA helicase has1 OS=Aspergillus fumigatus GN=has1 PE=3 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 2.046e-50
Identity = 95/161 (59.01%), Postives = 123/161 (76.40%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            EDLAR+S +  P+YI+VD  +   T EGL+QGY +  + KRF+LL+SFLKRNL KK++VFFSSCN VK+H+ELL YI +   ++HGKQKQQKRT TFF+FC A++G L+CTDVAARGLDIPAVDWI+Q+DPPD+P++      VG       AKG + +FL
Sbjct:  334 EDLARISLRPGPLYINVDHRKEHSTVEGLEQGYVICEADKRFLLLFSFLKRNLKKKIIVFFSSCNCVKYHAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAKQGTLICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHR--VGRTARGTNAKGRSLMFL 492          
The following BLAST results are available for this feature:
BLAST of EY665182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
RH27_ORYSJ5.028e-5761.66DEAD-box ATP-dependent RNA helicase 27 OS=Oryza sa... [more]
RH51_ARATH3.051e-5459.30DEAD-box ATP-dependent RNA helicase 51 OS=Arabidop... [more]
DDX18_DICDI1.085e-5160.87Probable ATP-dependent RNA helicase ddx18 OS=Dicty... [more]
HAS1_SCHPO1.851e-5163.98ATP-dependent RNA helicase has1 OS=Schizosaccharom... [more]
DDX18_MOUSE4.123e-5169.34ATP-dependent RNA helicase DDX18 OS=Mus musculus G... [more]
HAS1_NEUCR9.185e-5150.00ATP-dependent RNA helicase has-1 OS=Neurospora cra... [more]
HAS1_COCIM9.185e-5159.63ATP-dependent RNA helicase HAS1 OS=Coccidioides im... [more]
DDX18_HUMAN1.567e-5067.88ATP-dependent RNA helicase DDX18 OS=Homo sapiens G... [more]
HAS1_NEOFI2.046e-5059.01ATP-dependent RNA helicase has1 OS=Neosartorya fis... [more]
HAS1_ASPFU2.046e-5059.01ATP-dependent RNA helicase has1 OS=Aspergillus fum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665182 ID=EY665182|Name=EY665182|organism=Citrus sinensis|type=EST|length=1045bp
GAGGATCTTGCTCGCTTGTCATTTCAGACAACTCCAGTTTATATTGATGT
GGATGATGGGAGAACTAAGGTCACCAACGAAGGCCTGCAGCAAGGCTATT
GTGTGGTGCCCAGTGCCAAGAGATTTATCCTTCTATATTCCTTCTTGAAG
AGGAATCTGTCAAAGAAAGTGATGGTCTTCTTCTCCTCGTGTAATTCAGT
CAAATTTCATTCAGAACTTCTCAGATATATTCAGGTGGATTGCTTTGATA
TCCATGGAAAGCAAAAGCAACAGAAACGAACCACTACCTTCTTTGACTTC
TGCAAGGCGGAGAAGGGCATCTTGTTGTGTACTGATGTAGCTGCCCGTGG
ACTTGACATTCCTGCTGTGGACTGGATTGTGCAGTATGATCCTCCTGATG
AACCCAAGGAATAATATTCTTCGGGTGGGGTCGGGACAGCCCCGTGGAAG
AAAGGTGCAAAAGGAAATGCCCCACTTTTTCTTGATTCCAGAAAGAATTT
ACATTTTCCTTCCATATTCTGAAGGGCTGGCAAAAATCCCCTGGTTAAAA
AAATTATGAATTTTGAACCAAAAAAAACTGGGTCTAAGGTGCAGTCCCCT
TCCGGGGAAAAAATTGGGTTGGCTAACACCTATTTAATTTTGAAACCAAC
CCCCCCTAAAAATGGCGTTACGCATTTTTTATTTCCATACCAATAGATTT
CCCCACCCCCTAAGAAAGAATAAATCTTCCAAGGTATACCCCCCCCTATT
GATTTGGAAGGGGGAACCCGCCCTCGTTTTTATTTATTGTTTTTTTTTCT
CCCCCCCCCCCTAGAGGGGGAAAAATCCAAACACATAGAAAACCACGCTG
GTCCCCTCTTATAATTTTTTAAAAAAATAAAAAACCACCCCAAAAAAACT
CACACAAAAGAGAACACAAAAACAAATTGGTTTTTTTCTCATTGAAAACA
CTCCACCCCCCTTTTTATTGGAGTGGTAGGAAACAGAAGAAAGAATAATA
AAAAATAAAAATAAAAATACACACCCCCCCCACTTTTGTTTTTAT
back to top