EY665178

Overview
NameEY665178
Unique NameEY665178
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665178 vs. ExPASy Swiss-Prot
Match: DHR12_HUMAN (Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 1.183e-29
Identity = 69/138 (50.00%), Postives = 90/138 (65.22%), Query Frame = 3
Query:  240 LCNSRFELNFAVNVLGTYTITELMVPLLEKAAPDARVITVSSGGMYTAHL-TDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWVGFTA 650
            L     E NFA N LG Y +T  ++P+LEK   D RVITVSSGGM    L T+DL+     FDG   YA+NKR QV LTE+W++ +    I F SMHPGWA+TPGV ++MP F+ RF   LR+  +GADT+LW+  ++
Sbjct:  135 LTEDGLEKNFAANTLGVYILTTGLIPVLEKEH-DPRVITVSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQGHP--AIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLWLALSS 269          
BLAST of EY665178 vs. ExPASy Swiss-Prot
Match: DHR12_BOVIN (Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.308e-28
Identity = 68/134 (50.75%), Postives = 83/134 (61.94%), Query Frame = 3
Query:  240 LCNSRFELNFAVNVLGTYTITELMVPLLEKAAPDARVITVSSGGMYTAHL-TDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWV 638
            L     E NFA N LG Y +T  ++P+LEK   D RVITVSSGGM    L TDD +    +FDG   YA+NKR QV LTE+W+  +    I F  MHPGW +TPGV  SMP F+ R    LR+  +GADTVLW+
Sbjct:  135 LTEDGLEKNFATNTLGVYVLTTALIPVLEKEH-DPRVITVSSGGMLVQKLNTDDPQSERTAFDGTMVYAQNKRQQVVLTERWARAH--PAIHFSCMHPGWVDTPGVRLSMPGFHARLGARLRSEAQGADTVLWL 265          
The following BLAST results are available for this feature:
BLAST of EY665178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
DHR12_HUMAN1.183e-2950.00Dehydrogenase/reductase SDR family member 12 OS=Ho... [more]
DHR12_BOVIN1.308e-2850.75Dehydrogenase/reductase SDR family member 12 OS=Bo... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-074-H10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665178 ID=EY665178|Name=EY665178|organism=Citrus sinensis|type=EST|length=881bp
CCACGCGTCCGCGGACGCGTGGGAGCTATCACTGGGTTTTATTCTCGAAA
CTGATGAAAAATGTGATTTCCCTGTCCTTTACTACATTAGGTTAACAATG
CTGGCGTGCTTGAAAATAACCGATTAATCACATCTGAAGGGTACATAATC
ACTTCTTGGTATTATGTGTTCAAGGACAGATTAAATATGTTGCCTCTATT
TTGATCTCCTTGAAAATTCATGCTCTTCCATTTTATTTTCTCTGTAACTC
CAGATTTGAGTTAAACTTTGCTGTAAATGTATTGGGCACATACACCATAA
CAGAATTAATGGTTCCTTTGCTGGAGAAAGCTGCACCTGATGCTCGAGTG
ATCACAGTTTCCTCTGGAGGAATGTATACAGCTCACTTAACTGATGATCT
AGAGTTTAACAGTGGAAGCTTTGATGGGATGGAACAATATGCTCGAAACA
AGCGAGTCCAGGTGGCACTAACTGAAAAGTGGTCTGAAATGTACAAGGAG
AAGGGGATTGGGTTCTACTCAATGCACCCAGGGTGGGCTGAGACACCTGG
TGTGGCCAAGAGTATGCCTAGTTTTAATGAAAGGTTTGCCGGGAATCTTC
GAACAAGTGAGGAAGGTGCAGATACAGTCCTTTGGGTTGGCTTTACAGCC
AAAAGAGAAATTAGTATCAGGTTCATTTTATTTTGATAGGGCTGAAGCAC
CTAAACACCTTAAGTTTGCGGCTACTGCTGCCTCTCATGCAAGAATTGAC
CCCATTGTAGACGTTCTTCGTTTCATGGGCAACCTTCGTTAACGAATTAA
ACTATCAATATTGTCTACTTTTTGACGTCNTTATAGAAAATTTGATTGTA
AATTTGATCTACAAGTTAAAAGTGAAGAATG
back to top