CX043370

Overview
NameCX043370
Unique NameCX043370
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length807
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: TPT_FLAPR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 1.605e-123
Identity = 219/258 (84.88%), Postives = 235/258 (91.09%), Query Frame = 1
Query:   34 KKEILRPILATASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLF 807
            K+++L+P  ATAS      DSAG+AAPV FF +YP LVTGFFFFMWYFLNVIFNILNK+IYNYFPYPYFVS IHL VGVVYCL  WAVGLPKRAP+DS LLKLLIPVA CHALGHVTSNVSFAAVAVSFTHTIK+LEPFFNAAASQFILGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTN+YAYISII+L  CIPPAII+EGPQL+KHG SDAI+KVGM KFISDLF
Sbjct:   74 KRDVLKPCTATAS------DSAGDAAPVGFFAKYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSAIHLAVGVVYCLGGWAVGLPKRAPMDSNLLKLLIPVAFCHALGHVTSNVSFAAVAVSFTHTIKSLEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIISLLFCIPPAIILEGPQLLKHGFSDAIAKVGMTKFISDLF 325          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: TPT_PEA (Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 1.775e-122
Identity = 220/257 (85.60%), Postives = 233/257 (90.66%), Query Frame = 1
Query:   43 ILRPILATASSPAEGSDSAGE--AAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLF 807
            +LRP  ATA     G+DSAGE   APV FF RYPAL TGFFFF WYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCLVSW VGLPKRAPID  LLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHT+KALEPFFNAAASQFILGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIAL VCIPPA+I+EGP L+K G +DAI+KVG+VKF+SDLF
Sbjct:   67 LLRPCPATAG----GNDSAGEEKVAPVGFFSRYPALTTGFFFFTWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLVSWTVGLPKRAPIDGNLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTVKALEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALIVCIPPALIIEGPTLLKTGFNDAIAKVGLVKFVSDLF 319          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: TPT_FLATR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 3.028e-122
Identity = 214/258 (82.95%), Postives = 234/258 (90.70%), Query Frame = 1
Query:   34 KKEILRPILATASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLF 807
            K+++L+P  ATAS      DSAG+AAPV F  +YP LVTGFFFFMWYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCL SW VGLPKRAP+DS +LKLLIPV  CHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQF+LGQ +P++LWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL  CIPPA++ EGPQL+KHG +DAI+KVGM+KFISDLF
Sbjct:   73 KRDVLKPCSATAS------DSAGDAAPVGFLAKYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLGSWTVGLPKRAPVDSNILKLLIPVGFCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFVLGQSIPISLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIIALLFCIPPAVLFEGPQLLKHGFNDAIAKVGMIKFISDLF 324          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: TPT_SPIOL (Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 1.661e-120
Identity = 209/248 (84.27%), Postives = 227/248 (91.53%), Query Frame = 1
Query:   64 TASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLF 807
            TA  P   +  +   A   F ++YPALVTG FFFMWYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCL SW+VGLPKRAP+DSKLLKLLIPVAVCHA+GHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQF+LGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISN+SFTYRS+YSKKAMTDMDSTNIYAYISIIALFVC+PPAIIVEGPQL+KHG +DAI+KVG+ KFISDLF
Sbjct:   74 TAVQPCRAASGSSGEAKTGFLEKYPALVTGSFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLFVGVVYCLASWSVGLPKRAPMDSKLLKLLIPVAVCHAIGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFVLGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNVSFTYRSLYSKKAMTDMDSTNIYAYISIIALFVCLPPAIIVEGPQLMKHGFNDAIAKVGLTKFISDLF 321          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: TPT1_BRAOB (Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 1.406e-119
Identity = 211/258 (81.78%), Postives = 235/258 (91.09%), Query Frame = 1
Query:   34 KKEILRPILATASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLF 807
            K+EIL+P+ A +   AEG DSAGE   V F  +YP LVTG    MWYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCLVSW+VGLPKRAP++S +LK+LIPVAVCHA+GHVTSNVSFAAVAVSFTHTIKALEPFFNA+ASQF+LGQ +P+TLWLSLAPVV+GV+MASLTELSFNW GFISAMISNISFTYRSI+SKKAMTDMDSTN+YAYISIIALFVC+PPAIIVEGPQL+KHG +DAI+KVGM KFISDLF
Sbjct:   71 KREILKPVRAAS---AEGGDSAGETK-VGFLGKYPWLVTGILLLMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLFVGVVYCLVSWSVGLPKRAPVNSDILKVLIPVAVCHAIGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFLLGQPIPITLWLSLAPVVLGVAMASLTELSFNWLGFISAMISNISFTYRSIFSKKAMTDMDSTNVYAYISIIALFVCLPPAIIVEGPQLLKHGFNDAIAKVGMTKFISDLF 324          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: TPT_MAIZE (Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 1.191e-118
Identity = 203/248 (81.85%), Postives = 229/248 (92.34%), Query Frame = 1
Query:   64 TASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLF 807
            T   PA  ++SAGEA  V F ++YPALVTGFFFFMWYFLNVIFNILNK+IYNYFPYPYFVS+IHL+VGVVYCL+SW+VGLPKRAPI+  LLKLL PVA+CH +GH+TSNVSFAAVAVSF HTIKALEPFF+AAA+QFILGQQ+P +LWLSLAPVVIGVSMASLTELSFNWTGFI+AMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL VCIPPA+I EGP+L++HG SDAI+KVG+ KF+SDLF
Sbjct:   80 TLQPPAAAAESAGEAKSVGFLEKYPALVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSLIHLVVGVVYCLISWSVGLPKRAPINGTLLKLLFPVALCHGIGHITSNVSFAAVAVSFAHTIKALEPFFSAAATQFILGQQVPFSLWLSLAPVVIGVSMASLTELSFNWTGFINAMISNISFTYRSIYSKKAMTDMDSTNVYAYISIIALIVCIPPALIFEGPKLMQHGFSDAIAKVGLTKFVSDLF 327          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: TPT_SOLTU (Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 6.533e-117
Identity = 208/258 (80.62%), Postives = 229/258 (88.76%), Query Frame = 1
Query:   34 KKEILRPILATASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLF 807
            K+E ++P  A ASS A  SDS+G+A  V FF++   L TGFFFFMWYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCLVSW VGLPKRAPIDS  LKLL PVA CHALGHVTSNVSFAAV VSFTHT+KALEPFFNAAASQFILGQQ+PL LWLSLAPVV+GVSMASLTELSFNW GF SAMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL  C+PPAI +EGPQL++HG +DAI+KVG+ KF++DLF
Sbjct:   76 KRESIKPCSAAASSSAGSSDSSGDAK-VGFFNK-ATLTTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLVSWGVGLPKRAPIDSTQLKLLTPVAFCHALGHVTSNVSFAAVRVSFTHTVKALEPFFNAAASQFILGQQIPLALWLSLAPVVLGVSMASLTELSFNWLGFTSAMISNISFTYRSIYSKKAMTDMDSTNVYAYISIIALIFCLPPAIFIEGPQLLQHGFNDAIAKVGLTKFVTDLF 331          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: GPT1_ARATH (Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.062e-50
Identity = 98/215 (45.58%), Postives = 142/215 (66.05%), Query Frame = 1
Query:  142 LVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAM--TDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVG 780
            L  G +F  W+ LNV+FNI NK++ N +PYP+  S + L  G +  L+SWAVG+ +    D    K L PVAV H +GHV + VS + VAVSFTH IK+ EP F+   S+FILG+  P +++LSL P++ G ++++LTEL+FN  GF+ AMISN++F +R+I+SKK M    +   N YA +S+++L +  P AI VEGPQ+   G   A++ VG
Sbjct:   95 LKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAVGIVETPKTDFDFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFILGETFPTSVYLSLIPIIGGCALSALTELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQMWVDGWQTALATVG 309          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: GPT2_ARATH (Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.617e-49
Identity = 97/215 (45.12%), Postives = 141/215 (65.58%), Query Frame = 1
Query:  142 LVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAM--TDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVG 780
            L  G +F  W+ LNV+FNI NK++ N FPYP+  S + L  G +  LVSWA  +      D +  K L PVAV H +GHV + VS + VAVSFTH IK+ EP F+   S+F +G+  PL ++LSL P++ G ++A++TEL+FN TGF+ AMISN++F +R+I+SKK M    +   N YA +S+++L +  P +I VE PQ+   G  +A+S+VG
Sbjct:   95 LKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIADAPKTDLEFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFFMGETFPLPVYLSLLPIIGGCALAAITELNFNITGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLVILTPFSIAVEVPQMWAAGWQNAVSQVG 309          
BLAST of CX043370 vs. ExPASy Swiss-Prot
Match: TPT2_BRAOB (Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 8.438e-40
Identity = 95/256 (37.11%), Postives = 147/256 (57.42%), Query Frame = 1
Query:    1 SSNAPAGLFAGKKEILRPILAT------ASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWL--SLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMT----DMDSTNIYAYISIIALFVCIPPAIIVEG 732
            SS++P   ++G   +  P L T      A++  E  + +G+   V        L  G  F MWY  N+ FNI NK++      P  V+++   VG V     WA+ L KR  I +  L  ++P+AV H LG++ +N+S   V+VSFTHTIKA+EPFF+   S   LG ++P T W+  S+ P+V GV++AS+TE+SFNW GF+SAM SN++   R++ SKK M      +D+  +++ I++++LF+  P     EG
Sbjct:   55 SSDSPLRAWSGLPSVSSPSLDTNRFKTAATAVPEEGEGSGKMTKV--------LELGLLFAMWYLFNIYFNIYNKQVLKALHAPMTVTLVQFAVGSVLITFMWALNLYKRPKISAAQLAAILPLAVVHTLGNLFTNMSLGKVSVSFTHTIKAMEPFFSVVLSAMFLG-EVP-TPWVIGSIIPIVGGVALASVTEVSFNWAGFLSAMASNLTNQSRNVLSKKVMVKKDDSLDNITLFSIITLMSLFLMAPVTFFSEG 300          
The following BLAST results are available for this feature:
BLAST of CX043370 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
TPT_FLAPR1.605e-12384.88Triose phosphate/phosphate translocator, chloropla... [more]
TPT_PEA1.775e-12285.60Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLATR3.028e-12282.95Triose phosphate/phosphate translocator, chloropla... [more]
TPT_SPIOL1.661e-12084.27Triose phosphate/phosphate translocator, chloropla... [more]
TPT1_BRAOB1.406e-11981.78Triose phosphate/phosphate translocator, chloropla... [more]
TPT_MAIZE1.191e-11881.85Triose phosphate/phosphate translocator, chloropla... [more]
TPT_SOLTU6.533e-11780.62Triose phosphate/phosphate translocator, chloropla... [more]
GPT1_ARATH1.062e-5045.58Glucose-6-phosphate/phosphate translocator 1, chlo... [more]
GPT2_ARATH2.617e-4945.12Glucose-6-phosphate/phosphate translocator 2, chlo... [more]
TPT2_BRAOB8.438e-4037.11Triose phosphate/phosphate translocator, non-green... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10F04_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10F04-L8-1-7.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043370 ID=CX043370; Name=CX043370; organism=Citrus sinensis; type=EST; length=807bp
AGCTCCAATGCTCCGGCTGGTCTTTTCGCCGGAAAGAAGGAGATTCTCCG
TCCAATCCTCGCCACCGCTTCTTCTCCTGCCGAAGGAAGCGATTCCGCCG
GAGAAGCTGCTCCGGTCAGATTCTTTGACAGGTATCCGGCCCTCGTGACC
GGGTTCTTCTTCTTCATGTGGTACTTCCTGAACGTGATATTCAACATTCT
TAACAAGAGGATTTACAATTACTTCCCATATCCTTATTTTGTGTCCGTTA
TTCATTTGTTGGTTGGGGTGGTTTACTGTTTGGTGAGCTGGGCTGTGGGC
CTTCCCAAGCGAGCTCCTATTGATTCAAAACTCCTGAAGCTCTTAATCCC
TGTTGCTGTGTGTCATGCATTGGGCCATGTTACCAGCAACGTGTCTTTTG
CAGCAGTTGCTGTCTCCTTTACCCATACCATCAAAGCTCTTGAGCCCTTC
TTCAACGCTGCTGCTTCACAATTCATTCTAGGCCAACAGTTACCTCTGAC
TCTGTGGCTGTCTCTTGCTCCTGTGGTTATTGGAGTGTCAATGGCATCAT
TGACTGAGCTGTCGTTCAATTGGACGGGCTTCATTAGTGCTATGATTTCC
AACATATCGTTTACTTACAGGAGTATCTACTCCAAGAAAGCCATGACTGA
TATGGACAGTACTAATATTTATGCCTATATTTCCATCATTGCGCTCTTTG
TCTGTATTCCACCAGCCATCATTGTTGAGGGACCTCAACTGATTAAGCAT
GGCTTAAGTGATGCAATTTCCAAAGTGGGCATGGTCAAGTTCATTTCAGA
TCTTTTT
back to top