EH117790

Overview
NameEH117790
Unique NameEH117790
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length229
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig765 contig Csv1_Contig765:1148..1376. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_MOUSE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Mus musculus GN=Ddost PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.858e-25
Identity = 52/73 (71.23%), Postives = 61/73 (83.56%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMMAG FIF+IV L+ K
Sbjct:  363 QFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMK 435          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_RAT (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Rattus norvegicus GN=Ddost PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.140e-25
Identity = 50/73 (68.49%), Postives = 61/73 (83.56%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMMAG F+F++V L+ K
Sbjct:  363 QFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFLFSVVFLHMK 435          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_PONAB (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Pongo abelii GN=DDOST PE=2 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 7.061e-25
Identity = 51/73 (69.86%), Postives = 60/73 (82.19%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF+IV L+ K
Sbjct:  361 QFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK 433          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_HUMAN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens GN=DDOST PE=1 SV=4)

HSP 1 Score: 112.464 bits (280), Expect = 7.061e-25
Identity = 51/73 (69.86%), Postives = 60/73 (82.19%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF+IV L+ K
Sbjct:  378 QFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK 450          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_BOVIN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Bos taurus GN=DDOST PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 9.223e-25
Identity = 50/73 (68.49%), Postives = 60/73 (82.19%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF++V L+ K
Sbjct:  361 QFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSVVFLHMK 433          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_PIG (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Sus scrofa GN=DDOST PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 1.205e-24
Identity = 50/73 (68.49%), Postives = 59/73 (80.82%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF++V L+ K
Sbjct:  361 QFKFPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMVGLFIFSVVFLHMK 433          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_DANRE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Danio rerio GN=ddost PE=2 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 2.055e-24
Identity = 48/73 (65.75%), Postives = 61/73 (83.56%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+A+PYY SAFSMMAG F+F++V L+ +
Sbjct:  363 QFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAFPYYASAFSMMAGLFVFSVVFLHMR 435          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_CANFA (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Canis familiaris GN=DDOST PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.055e-24
Identity = 50/73 (68.49%), Postives = 59/73 (80.82%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF+ V L+ K
Sbjct:  367 QFKLPDVYGVFQFKVDYNRLGYTHLHSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSTVFLHMK 439          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_CHICK (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Gallus gallus GN=DDOST PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.505e-24
Identity = 49/73 (67.12%), Postives = 59/73 (80.82%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY  AFSMM G F+F+IV L+ K
Sbjct:  335 QFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYAGAFSMMVGLFMFSIVFLHMK 407          
BLAST of EH117790 vs. ExPASy Swiss-Prot
Match: OST48_XENLA (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus laevis GN=ddost PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 4.577e-24
Identity = 50/73 (68.49%), Postives = 60/73 (82.19%), Query Frame = -1
Query:    2 QFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 220
            QFK+PDVYGVFQFKV+Y RLGYT L  + QI VRP +H +YERF+P+AYPYY SAFS+M G FIF+IV L+ K
Sbjct:  360 QFKLPDVYGVFQFKVDYNRLGYTHLYSTTQISVRPLQHTQYERFIPSAYPYYASAFSVMFGLFIFSIVFLHMK 432          
The following BLAST results are available for this feature:
BLAST of EH117790 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
OST48_MOUSE1.858e-2571.23Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_RAT4.140e-2568.49Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_PONAB7.061e-2569.86Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_HUMAN7.061e-2569.86Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_BOVIN9.223e-2568.49Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_PIG1.205e-2468.49Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_DANRE2.055e-2465.75Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_CANFA2.055e-2468.49Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_CHICK3.505e-2467.12Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_XENLA4.577e-2468.49Dolichyl-diphosphooligosaccharide--protein glycosy... [more]

Pages

back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw20 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117790 ID=EH117790|Name=EH117790|organism=Citrus sinensis|type=EST|length=229bp
ACTTGCTGTAAAGGTGAACGATGGTGAAGATAAAGAACCCAGCCATCATA
GAAAATGCTGATCCATAATATGGGTAAGCTGCTGGTAAAAATCTTTCGTA
TTCATTGTGTCTGTAGGGCCTGACTGGAATCTGTTTTGATAGGGATAAGC
TGGTGTATCCTAGTCTTTGGTACTCGACCTTGAATTGGAAGACTCCATAA
ACATCTGGAACCTTGAATTGGTACGCAGT
back to top