EH117777

Overview
NameEH117777
Unique NameEH117777
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length327
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1684 contig Csv1_Contig1684:1282..1606. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_POPTM (Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 8.001e-37
Identity = 75/91 (82.42%), Postives = 78/91 (85.71%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERFLEEE+KVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQFSLHILKHSTIVAKPRSF
Sbjct:  415 EFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_GLYEC (Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.365e-36
Identity = 75/91 (82.42%), Postives = 77/91 (84.62%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERFLEEES VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSK+DTAEKGGQFSLHILKHSTIVAKPRSF
Sbjct:  415 EFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTAEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_HELTU (Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.782e-36
Identity = 75/91 (82.42%), Postives = 77/91 (84.62%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERFLEEE+KVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDT EKGGQFSLHILKHSTIVAKPRSF
Sbjct:  415 EFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTDEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_CICAR (Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 2.328e-36
Identity = 75/91 (82.42%), Postives = 76/91 (83.52%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERFLEEES VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIV KPRSF
Sbjct:  414 EFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVCKPRSF 504          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_POPKI (Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 5.186e-36
Identity = 74/91 (81.32%), Postives = 77/91 (84.62%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERFLEE +KVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQFSLHILKHSTIVAKPRSF
Sbjct:  415 EFRPERFLEEGAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_PEA (Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 8.846e-36
Identity = 73/91 (80.22%), Postives = 77/91 (84.62%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERFLEEE+ VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQFSLHILKHSTIVAKPR+F
Sbjct:  415 EFRPERFLEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRAF 505          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_CATRO (Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 8.846e-36
Identity = 73/91 (80.22%), Postives = 77/91 (84.62%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERFLEEESKVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPG+SKIDT+EKGGQFSLHILKHSTIV KPR+F
Sbjct:  415 EFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSKIDTSEKGGQFSLHILKHSTIVLKPRTF 505          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_MEDSA (Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.155e-35
Identity = 74/91 (81.32%), Postives = 76/91 (83.52%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERFLEEES VEANGNDFRYLPFGVGRRSCP             GRLVQN ELLPPPGQSKIDT+EKGGQFSLHILKHSTIVAKPRSF
Sbjct:  416 EFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNVELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF 506          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_SOYBN (Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.971e-35
Identity = 73/91 (80.22%), Postives = 76/91 (83.52%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERF EEES VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQS+IDT+EKGGQFSLHILKHSTIVAKPRSF
Sbjct:  416 EFRPERFFEEESLVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIVAKPRSF 506          
BLAST of EH117777 vs. ExPASy Swiss-Prot
Match: TCMO_PHAAU (Trans-cinnamate 4-monooxygenase OS=Phaseolus aureus GN=CYP73A2 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.971e-35
Identity = 72/91 (79.12%), Postives = 76/91 (83.52%), Query Frame = -1
Query:   46 QFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVAKPRSF 318
            +FRPERF EEES VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQS+IDT+EKGGQFSLHILKHST+VAKPRSF
Sbjct:  415 EFRPERFFEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTVVAKPRSF 505          
The following BLAST results are available for this feature:
BLAST of EH117777 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
TCMO_POPTM8.001e-3782.42Trans-cinnamate 4-monooxygenase OS=Populus tremulo... [more]
TCMO_GLYEC1.365e-3682.42Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza ech... [more]
TCMO_HELTU1.782e-3682.42Trans-cinnamate 4-monooxygenase OS=Helianthus tube... [more]
TCMO_CICAR2.328e-3682.42Trans-cinnamate 4-monooxygenase OS=Cicer arietinum... [more]
TCMO_POPKI5.186e-3681.32Trans-cinnamate 4-monooxygenase OS=Populus kitakam... [more]
TCMO_PEA8.846e-3680.22Trans-cinnamate 4-monooxygenase OS=Pisum sativum G... [more]
TCMO_CATRO8.846e-3680.22Trans-cinnamate 4-monooxygenase OS=Catharanthus ro... [more]
TCMO_MEDSA1.155e-3581.32Trans-cinnamate 4-monooxygenase OS=Medicago sativa... [more]
TCMO_SOYBN1.971e-3580.22Trans-cinnamate 4-monooxygenase OS=Glycine max GN=... [more]
TCMO_PHAAU1.971e-3579.12Trans-cinnamate 4-monooxygenase OS=Phaseolus aureu... [more]

Pages

back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw9 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117777 ID=EH117777|Name=EH117777|organism=Citrus sinensis|type=EST|length=327bp
GATGAGTCCTGAGTAACACTACAACCAAATGGAATTGTGAAACTAGAATG
ATCTAGGCTTGGCAACAATGGTCGAGTGCTTCAAAATGTGCAAACTGAAC
TGCCCACCTTTCTCTGCAGTGTCAATCTTAGATTGACCTGGAGGAGGCAA
GAGCTCAAAGTTCTGTACCAAACGCCCAATAGTGATACCAAGAATTGGCA
AAGCAAGGATAATTCCAGGGCAGCTTCTTCTCCCAACACCGAAAGGAAGG
TAACGGAAGTCATTTCCATTAGCCTCAACCTTGGACTCCTCCTCCAAAAA
CCTCTCAGGCCTGAATTGGTACGCAGT
back to top