EH117771

Overview
NameEH117771
Unique NameEH117771
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length239
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6_DEBHA (40S ribosomal protein S6 OS=Debaryomyces hansenii GN=RPS6 PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.757e-28
Identity = 57/76 (75.00%), Postives = 67/76 (88.16%), Query Frame = -1
Query:    3 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVVVTQDSS 230
            +FKGY+FR++GGNDK+GFPMKQGV+ P RV+LL++KGHS YRPRRTGERKRKSVRGCIV  DLAVL+L VV Q  S
Sbjct:   44 EFKGYIFRITGGNDKQGFPMKQGVMHPTRVKLLLAKGHSCYRPRRTGERKRKSVRGCIVAQDLAVLALSVVKQGDS 119          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6_CANGA (40S ribosomal protein S6 OS=Candida glabrata GN=RPS6A PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.966e-27
Identity = 56/71 (78.87%), Postives = 66/71 (92.96%), Query Frame = -1
Query:   18 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 230
            +FKGY F+++GGNDK+GFPMKQGVLLP RV+LL++KGHS YRPRR+GERKRKSVRG IVG DLAVLSLV+V
Sbjct:   44 EFKGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIVGPDLAVLSLVIV 114          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6_KLULA (40S ribosomal protein S6 OS=Kluyveromyces lactis GN=RPS6 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.470e-27
Identity = 54/70 (77.14%), Postives = 65/70 (92.86%), Query Frame = -1
Query:   21 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVV 230
            +FKGYVF+++GGNDK+GFPMKQGVLLP RV+LL++KGHS YRPRR GERKRKSVRG IVG DLAVL+L++
Sbjct:   44 EFKGYVFKIAGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRNGERKRKSVRGAIVGPDLAVLALII 113          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6B_SCHPO (40S ribosomal protein S6-B OS=Schizosaccharomyces pombe GN=rps6b PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.470e-27
Identity = 55/73 (75.34%), Postives = 63/73 (86.30%), Query Frame = -1
Query:   12 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVVVTQ 230
            +F GYVF+++GGNDK+GFPM QGVLLPHRVRLL+  GH  YRPRR GERKRKSVRGCIVG DLAVL+L +V Q
Sbjct:   44 EFAGYVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIVGQDLAVLALAIVKQ 116          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6A_SCHPO (40S ribosomal protein S6-A OS=Schizosaccharomyces pombe GN=rps6a PE=1 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 9.757e-27
Identity = 54/73 (73.97%), Postives = 63/73 (86.30%), Query Frame = -1
Query:   12 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVVVTQ 230
            +F GYVF+++GGNDK+GFPM QGVLLPHRVRLL+  GH  YRPRR GERKRKSVRGCIVG DLAVL+L ++ Q
Sbjct:   44 EFAGYVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIVGQDLAVLALAIIKQ 116          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6_KLUMA (40S ribosomal protein S6 OS=Kluyveromyces marxianus GN=RPS6 PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.274e-26
Identity = 56/71 (78.87%), Postives = 65/71 (91.55%), Query Frame = -1
Query:   18 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 230
            +FKGYVF+++GGNDK+GFPMKQGVLLP RV+LLM+KG S YRPRR GERKRKSVRG IVG DLAVL+LV+V
Sbjct:   44 EFKGYVFKIAGGNDKQGFPMKQGVLLPTRVKLLMAKGTSCYRPRRNGERKRKSVRGAIVGPDLAVLALVIV 114          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6_ASHGO (40S ribosomal protein S6 OS=Ashbya gossypii GN=RPS6 PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.842e-26
Identity = 54/70 (77.14%), Postives = 64/70 (91.43%), Query Frame = -1
Query:   21 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVV 230
            +FKGYVF+++GGNDK+GFPMKQGVLLP RV+LLM+KG S YRPRR GERKRKSVRG IVG DLAVL+L++
Sbjct:   44 EFKGYVFKIAGGNDKQGFPMKQGVLLPTRVKLLMAKGTSCYRPRRNGERKRKSVRGAIVGPDLAVLALII 113          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6_XENLA (40S ribosomal protein S6 OS=Xenopus laevis GN=rps6 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.324e-26
Identity = 55/71 (77.46%), Postives = 65/71 (91.55%), Query Frame = -1
Query:   18 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 230
            ++KGYV R+SGGNDK+GFPMKQGVL   RVRLL+SKGHS YRPRRTGERKRKSVRGCIV ++L+VL+LV+V
Sbjct:   44 EWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIV 114          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6_RAT (40S ribosomal protein S6 OS=Rattus norvegicus GN=Rps6 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.324e-26
Identity = 55/71 (77.46%), Postives = 65/71 (91.55%), Query Frame = -1
Query:   18 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 230
            ++KGYV R+SGGNDK+GFPMKQGVL   RVRLL+SKGHS YRPRRTGERKRKSVRGCIV ++L+VL+LV+V
Sbjct:   44 EWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIV 114          
BLAST of EH117771 vs. ExPASy Swiss-Prot
Match: RS6_MOUSE (40S ribosomal protein S6 OS=Mus musculus GN=Rps6 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.324e-26
Identity = 55/71 (77.46%), Postives = 65/71 (91.55%), Query Frame = -1
Query:   18 QFKGYVFRVSGGNDKRGFPMKQGVLLPHRVRLLMSKGHSYYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 230
            ++KGYV R+SGGNDK+GFPMKQGVL   RVRLL+SKGHS YRPRRTGERKRKSVRGCIV ++L+VL+LV+V
Sbjct:   44 EWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIV 114          
The following BLAST results are available for this feature:
BLAST of EH117771 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
RS6_DEBHA6.757e-2875.0040S ribosomal protein S6 OS=Debaryomyces hansenii ... [more]
RS6_CANGA1.966e-2778.8740S ribosomal protein S6 OS=Candida glabrata GN=RP... [more]
RS6_KLULA7.470e-2777.1440S ribosomal protein S6 OS=Kluyveromyces lactis G... [more]
RS6B_SCHPO7.470e-2775.3440S ribosomal protein S6-B OS=Schizosaccharomyces ... [more]
RS6A_SCHPO9.757e-2773.9740S ribosomal protein S6-A OS=Schizosaccharomyces ... [more]
RS6_KLUMA1.274e-2678.8740S ribosomal protein S6 OS=Kluyveromyces marxianu... [more]
RS6_ASHGO4.842e-2677.1440S ribosomal protein S6 OS=Ashbya gossypii GN=RPS... [more]
RS6_XENLA6.324e-2677.4640S ribosomal protein S6 OS=Xenopus laevis GN=rps6... [more]
RS6_RAT6.324e-2677.4640S ribosomal protein S6 OS=Rattus norvegicus GN=R... [more]
RS6_MOUSE6.324e-2677.4640S ribosomal protein S6 OS=Mus musculus GN=Rps6 P... [more]

Pages

back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw4 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117771 ID=EH117771|Name=EH117771|organism=Citrus sinensis|type=EST|length=239bp
GACGATGAGTCCTGAGTAACTACAACGAGAGACAAGACAGCGAGGTCAGA
ACCAACGATACAACCACGAACGGACTTCCTCTTACGTTCACCAGTACGGC
GAGGACGATAATAAGAGTGACCCTTGGACATCAAGAGACGAACACGGTGA
GGTAAGAGAACACCTTGCTTCATGGGGAAACCTCGCTTATCGTTACCACC
AGAGACACGGAAAACGTAACCCTTGAATTGGTACGCAGT
back to top