CX671688

Overview
NameCX671688
Unique NameCX671688
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length705
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC2_MESCR (Superoxide dismutase [Cu-Zn] 2 OS=Mesembryanthemum crystallinum GN=SODCC.2 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.809e-54
Identity = 98/121 (80.99%), Postives = 106/121 (87.60%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGK 450
            +I+G  +VKGSL F+Q   GVTHVKG+ITGL PGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAP D ERH GDLGN+VAG DGVAEVS+ D  IPLSGQHSILGRAVVVHAD DDLG+
Sbjct:    9 VINGNNNVKGSLQFIQDSTGVTHVKGRITGLTPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPFDTERHAGDLGNVVAGADGVAEVSVRDTQIPLSGQHSILGRAVVVHADQDDLGR 129          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC_PINSY (Superoxide dismutase [Cu-Zn] OS=Pinus sylvestris GN=SODCC PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.268e-46
Identity = 85/122 (69.67%), Postives = 97/122 (79.51%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            +++GA  VKG + F Q  +G T V GKI+GL PGLHGFH+HALGDTTNGC STGPHFNPL K+HGAP+D+ RH GDLGN+  G DG  E SI D  IPLSG HSI+GRAVVVHADPDDLGKG
Sbjct:    9 VLNGAADVKGVVQFTQEGDGPTTVTGKISGLSPGLHGFHVHALGDTTNGCMSTGPHFNPLGKEHGAPTDDNRHAGDLGNVTVGTDGTVEFSITDSQIPLSGPHSIVGRAVVVHADPDDLGKG 130          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC2_MAIZE (Superoxide dismutase [Cu-Zn] 2 OS=Zea mays GN=SODCC.1 PE=2 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 8.221e-46
Identity = 83/121 (68.60%), Postives = 96/121 (79.34%), Query Frame = 1
Query:   91 ISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            +   T VKG++ F Q  +G T V G I+GLKPGLHGFH+HALGDTTNGC STGPHFNP+ K+HGAP D +RH GDLGN+ AG DGV  V+I D  IPL+G HSI+GRAVVVHADPDDLGKG
Sbjct:    7 VLAGTDVKGTIFFSQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPVGKEHGAPEDEDRHAGDLGNVTAGEDGVVNVNITDSQIPLAGPHSIIGRAVVVHADPDDLGKG 127          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC2_ORYSJ (Superoxide dismutase [Cu-Zn] 2 OS=Oryza sativa subsp. japonica GN=SODCC2 PE=1 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 1.074e-45
Identity = 82/122 (67.21%), Postives = 98/122 (80.33%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            +++ +  VKG++ F Q  +G T V G ++GLKPGLHGFH+HALGDTTNGC STGPHFNP  K+HGAP D  RH GDLGNI AG DGVA V+++D  IPL+G HSI+GRAVVVHADPDDLGKG
Sbjct:    7 VLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHADPDDLGKG 128          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC1_ORYSJ (Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. japonica GN=SODCC1 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.124e-45
Identity = 81/122 (66.39%), Postives = 97/122 (79.51%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            ++  +  VKG++HFVQ  +G T V G ++GLKPGLHGFHIHALGDTTNGC STGPH+NP  K+HGAP D  RH GDLGN+ AG DGVA + + D  IPL+G +SI+GRAVVVHADPDDLGKG
Sbjct:    7 VLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTGPHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHADPDDLGKG 128          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC1_ORYSI (Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. indica GN=SODCC1 PE=2 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 3.124e-45
Identity = 81/122 (66.39%), Postives = 97/122 (79.51%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            ++  +  VKG++HFVQ  +G T V G ++GLKPGLHGFHIHALGDTTNGC STGPH+NP  K+HGAP D  RH GDLGN+ AG DGVA + + D  IPL+G +SI+GRAVVVHADPDDLGKG
Sbjct:    7 VLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTGPHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHADPDDLGKG 128          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC5_MAIZE (Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SODCC.2 PE=2 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 2.025e-44
Identity = 78/122 (63.93%), Postives = 96/122 (78.69%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            ++  +  VKG++ F Q  +G T V G ++GLKPGLHGFH+HALGDTTNGC STGPH+NP  K+HGAP D  RH GDLGN+ AG DGVA +++ D  IPL+G +SI+GRAVVVHADPDDLGKG
Sbjct:    7 VLGSSDGVKGTIFFTQEGDGPTAVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHADPDDLGKG 128          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC4_MAIZE (Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SODCC.3 PE=2 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 2.025e-44
Identity = 78/122 (63.93%), Postives = 96/122 (78.69%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            ++  +  VKG++ F Q  +G T V G ++GLKPGLHGFH+HALGDTTNGC STGPH+NP  K+HGAP D  RH GDLGN+ AG DGVA +++ D  IPL+G +SI+GRAVVVHADPDDLGKG
Sbjct:    7 VLGSSEGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHADPDDLGKG 128          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC_PANGI (Superoxide dismutase [Cu-Zn] OS=Panax ginseng GN=SODCC PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.645e-44
Identity = 80/122 (65.57%), Postives = 94/122 (77.05%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            ++SG+  V G +HF Q  +G T V GK++GL PGLHGFH+HALGDTTNGC STGPH+NP  K+HGAP D  RH GDLGN+  G DG AE +I D+ IPL G  SI+GRAVVVHADPDDLGKG
Sbjct:    7 VLSGSGGVSGVIHFTQEEDGPTTVTGKLSGLAPGLHGFHVHALGDTTNGCLSTGPHYNPANKEHGAPEDETRHAGDLGNVTVGEDGTAEFTIVDKQIPLIGSGSIIGRAVVVHADPDDLGKG 128          
BLAST of CX671688 vs. ExPASy Swiss-Prot
Match: SODC_ANACO (Superoxide dismutase [Cu-Zn] OS=Ananas comosus GN=SOD1 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.313e-43
Identity = 79/122 (64.75%), Postives = 93/122 (76.23%), Query Frame = 1
Query:   88 LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 453
            ++  +  VKG+++F Q  +G T V G I+GLKPGLHGFH+HALGDTTNGC STGPHFNP   +HGAP D  RH GDLGN+  G DG   V+I D  IPLSG +SI+GRAVVVHADPDDLGKG
Sbjct:    7 VLGSSEGVKGTIYFTQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGNEHGAPEDETRHAGDLGNVTVGEDGTVNVNIVDSQIPLSGSNSIIGRAVVVHADPDDLGKG 128          
The following BLAST results are available for this feature:
BLAST of CX671688 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 142
Match NameE-valueIdentityDescription
SODC2_MESCR4.809e-5480.99Superoxide dismutase [Cu-Zn] 2 OS=Mesembryanthemum... [more]
SODC_PINSY1.268e-4669.67Superoxide dismutase [Cu-Zn] OS=Pinus sylvestris G... [more]
SODC2_MAIZE8.221e-4668.60Superoxide dismutase [Cu-Zn] 2 OS=Zea mays GN=SODC... [more]
SODC2_ORYSJ1.074e-4567.21Superoxide dismutase [Cu-Zn] 2 OS=Oryza sativa sub... [more]
SODC1_ORYSJ3.124e-4566.39Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa sub... [more]
SODC1_ORYSI3.124e-4566.39Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa sub... [more]
SODC5_MAIZE2.025e-4463.93Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SO... [more]
SODC4_MAIZE2.025e-4463.93Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SOD... [more]
SODC_PANGI2.645e-4465.57Superoxide dismutase [Cu-Zn] OS=Panax ginseng GN=S... [more]
SODC_ANACO1.313e-4364.75Superoxide dismutase [Cu-Zn] OS=Ananas comosus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_12E09_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-12E09-J18-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671688 ID=CX671688|Name=CX671688|organism=Citrus sinensis|type=EST|length=705bp
ATTTGATATCGAGAAGACCCAGATAGAGAAAGCAAGAGATAAAAAATGGA
AACAGGGGCTACAAAAGCCACAGTGAAAGCCGTGGCTCTCATTTCTGGTG
CTACCAGCGTTAAAGGCTCTCTTCACTTTGTTCAAGGACCCAACGGAGTT
ACACATGTGAAAGGGAAGATTACAGGACTGAAGCCAGGCCTTCATGGCTT
CCATATTCACGCCCTCGGTGACACCACTAATGGTTGCAATTCTACTGGAC
CTCATTTCAATCCATTGAAGAAGGATCATGGGGCTCCCAGTGATAACGAG
CGGCACACTGGTGATTTGGGAAACATTGTTGCAGGCCCTGATGGAGTTGC
TGAGGTTTCAATTGCTGACAGGATGATTCCTCTGAGCGGGCAACACTCAA
TATTGGGGAGGGCTGTTGTTGTGCACGCTGATCCTGATGATCTTGGAAAA
GGCAAGTTTAGTAGTTTGTCCTTAATTTTGATTACAAATCTTTTTTATTA
CAAGGATACAGCTTATTGGTACAAATGTACACAAAAGTATGTTTATTTTA
AACTGTCAGTTCTTTTGGAGAATAATATGTCAGGTTGAAGCTTTAGGTAA
GGATGTACAATTTTTTTTTCTTCCTCTTAGTTTCAGGTACATTGGATTCT
TTACAACTACTTTGAAGAGTTTAGTTTTAAATGTAAGAAATTCAGTGTAG
TTTGT
back to top