CX671664

Overview
NameCX671664
Unique NameCX671664
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length800
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13580 contig Csv1_Contig13580:448..1247. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRK40_ARATH (Probable WRKY transcription factor 40 OS=Arabidopsis thaliana GN=WRKY40 PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.099e-51
Identity = 107/196 (54.59%), Postives = 137/196 (69.90%), Query Frame = -1
Query:  189 CKRPKDNNT-KAKVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQPT--DSKAELSLSPSHVATIGNPIHVSAASSMLSASPTATLDMIQPGFLFDDAKK--SSVQQIEAPAIHQILVQQMASNLTKDPNFTAALAAAISGRFADQARTQR 761
            CK+ ++    K KVSR Y +   S++TL+VKDGYQWRKYGQKVTRDNPSPRAYFKC+ APSC VKKKVQRS ED S+LVATYEGEHNHP P+  DS   L+   SH  +   P+  +  SS+    P  T+DMI       ++KK  S   +I+ P + ++LV+QMAS+LTKDPNFTAALAAA++G+   Q  T++
Sbjct:  116 CKKQREETVVKEKVSRVYYKTEASDTTLVVKDGYQWRKYGQKVTRDNPSPRAYFKCACAPSCSVKKKVQRSVEDQSVLVATYEGEHNHPMPSQIDSNNGLNRHISHGGSASTPVAANRRSSL--TVPVTTVDMI-------ESKKVTSPTSRIDFPQVQKLLVEQMASSLTKDPNFTAALAAAVTGKLYQQNHTEK 302          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRK18_ARATH (WRKY transcription factor 18 OS=Arabidopsis thaliana GN=WRKY18 PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 1.557e-46
Identity = 102/191 (53.40%), Postives = 128/191 (67.02%), Query Frame = -1
Query:  195 CKRP-KDNNTKAKVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQPTDSKAELSLSPSHVATIGNPIHVSAASSMLSASPTATLDMIQPGFLFDDAKKSSVQQIEAP-AIHQILVQQMASNLTKDPNFTAALAAAISGRFADQART 761
            CKRP  D+  KAKVS  YV    S+++L VKDG+QWRKYGQKVTRDNPSPRAYF+CSFAPSCPVKKKVQRSAEDPS+LVATYEG HNH  P  S+ +                    ++    S T TLD++      +   + ++++ E    + ++L+QQMAS+LTKD  FTAALAAAISGR  +Q+RT
Sbjct:  146 CKRPVTDSFNKAKVSTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSCPVKKKVQRSAEDPSLLVATYEGTHNHLGPNASEGD--------------------ATSQGGSSTVTLDLV------NGCHRLALEKNERDNTMQEVLIQQMASSLTKDSKFTAALAAAISGRLMEQSRT 310          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRK60_ARATH (Probable WRKY transcription factor 60 OS=Arabidopsis thaliana GN=WRKY60 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 9.444e-44
Identity = 99/182 (54.40%), Postives = 113/182 (62.09%), Query Frame = -1
Query:  195 NTKAKVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQPTDSKAELSLSPSHVATIGNPIHVSAASSMLSASPTATLDMIQPGFLFDDAKKSSVQQIEAPAIHQILVQQMASNLTKDPNFTAALAAAISGRFADQART 740
            N KA VS  Y  A  S+++L VKDGYQWRKYGQK+TRDNPSPRAYF+CSF+PSC VKKKVQRSAEDPS LVATYEG HNH  P                              S S T  LD++Q G    + KK      E   I ++LVQQMAS+LTKDP FTAALA AISGR  + +RT
Sbjct:  124 NDKATVSTAYFAAEKSDTSLTVKDGYQWRKYGQKITRDNPSPRAYFRCSFSPSCLVKKKVQRSAEDPSFLVATYEGTHNHTGP----------------------------HASVSRTVKLDLVQGGLEPVEEKK------ERGTIQEVLVQQMASSLTKDPKFTAALATAISGRLIEHSRT 271          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRK47_ARATH (Probable WRKY transcription factor 47 OS=Arabidopsis thaliana GN=WRKY47 PE=2 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 4.408e-25
Identity = 88/225 (39.11%), Postives = 116/225 (51.56%), Query Frame = -1
Query:  222 KAKVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQP---------TDSKAELSLSPSHVA----TIGNPIHVSAAS-----------SMLSAS---PTATLDMIQP-----------------GFLFDDAKKSSV----QQIEAP------AIHQILVQQMASNLTKDPNFTAALAAAIS 734
            KA+VS   VRA    +T  V DG QWRKYGQK+ + NP PRAY++C+ A  CPV+K+VQR AED +IL  TYEG HNHP P         T + A + LS S  +    T+ +P   S++S           + LSAS   PT TLD+  P                  FL +  +  S+    QQ+  P      A  + +V  + + +  DPNFTAALAAAIS
Sbjct:  224 KARVS---VRARSDATT--VNDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDTTILTTTYEGNHNHPLPPSATAMAATTSAAAAMLLSGSSSSNLHQTLSSPSATSSSSFYHNFPYTSTIATLSASAPFPTITLDLTNPPRPLQPPPQFLSQYGPAAFLPNANQIRSMNNNNQQLLIPNLFGPQAPPREMVDSVRAAIAMDPNFTAALAAAIS 443          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRK31_ARATH (Probable WRKY transcription factor 31 OS=Arabidopsis thaliana GN=WRKY31 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 8.312e-24
Identity = 83/235 (35.32%), Postives = 117/235 (49.79%), Query Frame = -1
Query:  222 KAKVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQP---------TDSKAELSLSPSHVATIG--NPIHVSA------ASSMLSAS-----PTATLDMI---------------------QPGF------------LFDDAKKSSVQQIEAPAIHQIL---------VQQMASNLTKDPNFTAALAAAIS 734
            KA+VS   VRA   +   ++ DG QWRKYGQK+ + NP PRAY++C+ A  CPV+K+VQR AED SIL+ TYEG HNHP P         T + A + LS S  +  G  NP ++ A      +SSM + S     PT TLD+                      +PGF            ++++ ++S    ++ PA    +         V   ++ +  DPNF AALAAAI+
Sbjct:  282 KARVS---VRAR--SEAAMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAGGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAATAMASTTTAAASMLLSGSMSSQDGLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNGNNPNMTTNNPLMQFAQRPGFNPAVLPQVVGQAMYNNQQQSKFSGLQLPAQPLQIAATSSVAESVSAASAAIASDPNFAAALAAAIT 511          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRKY6_ARATH (WRKY transcription factor 6 OS=Arabidopsis thaliana GN=WRKY6 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 7.037e-23
Identity = 82/248 (33.06%), Postives = 111/248 (44.76%), Query Frame = -1
Query:  222 DNNTKAKVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQP---------TDSKAELSLSPSHVATIG--NPIHV--------SAASSMLSAS---PTATLDM--------------------------------------IQPGF--------LFDDAKKSSVQ-----QIEAPAIHQILVQQMASNLTKDPNFTAALAAAIS 746
            D   +A + +  V     +   ++ DG QWRKYGQK+ + NP PRAY++C+ A  CPV+K+VQR AED SIL+ TYEG HNHP P         T + A + LS S  +  G  NP ++        S + + +SAS   PT TLD+                                      + PG         L++ +K S +Q        A       V    + LT DPNFTAALAA IS
Sbjct:  288 DQTAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGSMSSHDGMMNPTNLLARAVLPCSTSMATISASAPFPTVTLDLTHSPPPPNGSNPSSSAATNNNHNSLMQRPQQQQQQMTNLPPGMLPHVIGQALYNQSKFSGLQFSGGSPSTAAFSQSHAVADTITALTADPNFTAALAAVIS 535          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRK72_ARATH (Probable WRKY transcription factor 72 OS=Arabidopsis thaliana GN=WRKY72 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.561e-22
Identity = 60/173 (34.68%), Postives = 97/173 (56.07%), Query Frame = -1
Query:  213 KVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQPTDSKAELSLSPSHVATIGNPIHVSAASSMLSASPTATLDMIQPGFLFDDAK-KSSVQQIEAPAIHQILVQQMASNLTKDPNFTAALAAAISGRF 728
            K +R  VRA     T+   DG QWRKYGQK+ + NP PRAY++C+ AP CPV+K+VQR A+D SIL+ TYEG H+H  P  +    S +             +AAS +LS S ++    +    L+D+++  ++ +   +P +H  L   +  +LT   + +++ ++ +S  F
Sbjct:  211 KRARVCVRARCDTPTM--NDGCQWRKYGQKIAKGNPCPRAYYRCTVAPGCPVRKQVQRCADDMSILITTYEGTHSHSLPLSATTMASTTS------------AAASMLLSGSSSSPAAEMIGNNLYDNSRFNNNNKSFYSPTLHSPLHPTVTLDLTAPQHSSSSSSSLLSLNF 369          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRK61_ARATH (Probable WRKY transcription factor 61 OS=Arabidopsis thaliana GN=WRKY61 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 7.780e-22
Identity = 53/112 (47.32%), Postives = 73/112 (65.18%), Query Frame = -1
Query:  393 KVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQPTDSKAELSLSPSHVATIGNPIHVSAASSMLSAS 728
            K +R  VR+     T+   DG QWRKYGQK+ + NP PRAY++C+ A SCPV+K+VQR +ED SIL++TYEG HNHP P  + A  S + +  + +     +S ASS  SA+
Sbjct:  175 KKTRVSVRSRCETPTM--NDGCQWRKYGQKIAKGNPCPRAYYRCTIAASCPVRKQVQRCSEDMSILISTYEGTHNHPLPMSATAMASATSAAASML-----LSGASSSSSAA 279          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRK42_ARATH (Probable WRKY transcription factor 42 OS=Arabidopsis thaliana GN=WRKY42 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 7.780e-22
Identity = 78/229 (34.06%), Postives = 112/229 (48.91%), Query Frame = -1
Query:  222 KAKVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQP---------TDSKAELSLSPSHVAT---IGNPIHVSA------ASSMLSAS-----PTATLDMIQP--------GFLFDDAKKSSVQQIEAPAIHQILVQQMASN---------------------------LTKDPNFTAALAAAIS 734
            KA+VS   VRA      L   DG QWRKYGQK+ + NP PRAY++C+ A  CPV+K+VQR AED +IL+ TYEG HNHP P         T + A + LS S ++    + NP ++ A      +SSM + S     PT TLD+ +           L   +++S + ++    +  ++ Q +  N                           +  +PNF AALAAAI+
Sbjct:  277 KARVS---VRARSEAPML--SDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMNMASTTTAAASMLLSGSTMSNQDGLMNPTNLLARTILPCSSSMATISASAPFPTITLDLTESPNGNNPTNNPLMQFSQRSGLVELNQSVLPHMMGQALYYNQQSKFSGLHMPSQPLNAGESVSAATAAIASNPNFAAALAAAIT 500          
BLAST of CX671664 vs. ExPASy Swiss-Prot
Match: WRKY9_ARATH (Probable WRKY transcription factor 9 OS=Arabidopsis thaliana GN=WRKY9 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.016e-21
Identity = 51/91 (56.04%), Postives = 62/91 (68.13%), Query Frame = -1
Query:  468 NTKAKVSRFYVRASDSNSTLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHPQPTDSKAELS 740
            N KA+VS   VRA    +T+   DG QWRKYGQK  + NP PRAY++C+ AP CPV+K+VQR  ED SIL+ TYEG HNHP P  + A  S
Sbjct:  218 NRKARVS---VRARCETATM--NDGCQWRKYGQKTAKGNPCPRAYYRCTVAPGCPVRKQVQRCLEDMSILITTYEGTHNHPLPVGATAMAS 303          
The following BLAST results are available for this feature:
BLAST of CX671664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 61
Match NameE-valueIdentityDescription
WRK40_ARATH2.099e-5154.59Probable WRKY transcription factor 40 OS=Arabidops... [more]
WRK18_ARATH1.557e-4653.40WRKY transcription factor 18 OS=Arabidopsis thalia... [more]
WRK60_ARATH9.444e-4454.40Probable WRKY transcription factor 60 OS=Arabidops... [more]
WRK47_ARATH4.408e-2539.11Probable WRKY transcription factor 47 OS=Arabidops... [more]
WRK31_ARATH8.312e-2435.32Probable WRKY transcription factor 31 OS=Arabidops... [more]
WRKY6_ARATH7.037e-2333.06WRKY transcription factor 6 OS=Arabidopsis thalian... [more]
WRK72_ARATH4.561e-2234.68Probable WRKY transcription factor 72 OS=Arabidops... [more]
WRK61_ARATH7.780e-2247.32Probable WRKY transcription factor 61 OS=Arabidops... [more]
WRK42_ARATH7.780e-2234.06Probable WRKY transcription factor 42 OS=Arabidops... [more]
WRKY9_ARATH1.016e-2156.04Probable WRKY transcription factor 9 OS=Arabidopsi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_12D08_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-12D08-H16-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671664 ID=CX671664|Name=CX671664|organism=Citrus sinensis|type=EST|length=800bp
TTTTTTAAAAGGGAAAAATTCTCCTTTTTCGTTAATTTTGAAGTTCCATG
TAATGTACATTAATATTGCAAGGTATGGTCTCCAGACTCTAATCCTCCAT
TAAAGTAACTAAAGCAAAGCAAAAATACAGAAGTTGATACAAATTAACAT
CCATAATCTGTGTTGATCCTGGCTAGCTAGAGTGACCATCTTTGTGTTCG
GGCCTGATCAGCAAATCTTCCTGAAATAGCTGCTGCAAGTGCTGCTGTAA
AATTAGGATCTTTGGTCAAATTAGAAGCCATTTGTTGGACCAAAATCTGA
TGGATTGCTGGAGCTTCAATTTGTTGAACTGATGATTTTTTGGCATCATC
AAACAAAAATCCAGGTTGAATCATATCAAGAGTTGCAGTAGGGCTTGCTG
ATAGCATCGATGACGCCGCAGAAACATGAATAGGATTTCCAATAGTTGCA
ACATGGCTAGGGCTCAATGATAATTCAGCTTTTGAATCCGTAGGCTGAGG
ATGATTATGCTCTCCTTCATAAGTTGCCACTAAAATTGATGGATCCTCAG
CACTTCTTTGCACCTTCTTCTTTACGGGACAGCTTGGGGCGAAAGAACAC
TTGAAGTAAGCCCTAGGTGATGGGTTGTCTCTTGTAACCTTTTGGCCATA
CTTTCTCCATTGATACCCATCCTTCACAATCAGGGTTGAATTTGAATCAC
TGGCTCTCACATAAAACCTAGAAACTTTTGCCTTGGTGTTGTTATCCTTT
GGCCTTTTGCATGACTCTTCGTCAGTACTAGTGCTGGACTCAGTAGCGTG
back to top