CX043905

Overview
NameCX043905
Unique NameCX043905
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length746
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6651 contig Csv1_Contig6651:115..860. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043905 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 5.106e-41
Identity = 79/181 (43.65%), Postives = 112/181 (61.88%), Query Frame = 1
Query:  202 LSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSXETAVVYKSSERKKLEMKG 744
            L C +WR  VETNN+  W T+PE+CA YV  YM+G  Y+M+ + V++EA  YA+S+ L  DG+++W+FD+DET LSNLPYY+ + +G++ ++   F++WV  G A                G K+  LTGR E  R+VT  NL +AGF  W KLIL+GS    +TA  YKS  R  +  +G
Sbjct:   41 LKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPYYSDHRYGLEVFDDVEFDKWVENGTAPALGSSLKLYQEVLKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEG 221          
BLAST of CX043905 vs. ExPASy Swiss-Prot
Match: VSPA_SOYBN (Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.310e-40
Identity = 85/184 (46.20%), Postives = 116/184 (63.04%), Query Frame = 1
Query:  196 PGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKG-SSHSXETAVVYKSSERKKLEMKG 744
            P + C SWRL VE +N+ G+ T+PE+C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY K+G+GV+ +N TL++EWVN G A                G KI+FL+GR  D++ VTEANLK AG+ TWEKLILK     S   AV YK++ R+KL  +G
Sbjct:   38 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQG 219          
BLAST of CX043905 vs. ExPASy Swiss-Prot
Match: S25K_SOYBN (Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 3.310e-40
Identity = 85/184 (46.20%), Postives = 116/184 (63.04%), Query Frame = 1
Query:  196 PGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKG-SSHSXETAVVYKSSERKKLEMKG 744
            P + C SWRL VE +N+ G+ T+PE+C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY K+G+GV+ +N TL++EWVN G A                G KI+FL+GR  D++ VTEANLK AG+ TWEKLILK     S   AV YK++ R+KL  +G
Sbjct:   35 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQG 216          
BLAST of CX043905 vs. ExPASy Swiss-Prot
Match: VSPB_SOYBN (Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.439e-35
Identity = 81/190 (42.63%), Postives = 115/190 (60.53%), Query Frame = 1
Query:  175 GSRNNDVPGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSXETAVVYKSSERKKLEMKG 744
            G R+++V    C S+RL VE +N+  + T+PE+C      Y+ G+Q+R DS+ V  +A  YA   ++  +  +I++F ID T LSN+PYY K+G+GV+ +N TL++EWVN G A                G KIVFL+GR  D+  VTEANLK AGF TWE+LILK        A+ YKS+ R+ L  +G
Sbjct:   35 GERSSEV---KCASFRLAVEAHNIRAFKTIPEECVEPTKDYINGEQFRSDSKTVNQQAFFYASEREVHHN--DIFIFGIDNTVLSNIPYYEKHGYGVEEFNETLYDEWVNKGDAPALPETLKNYNKLLSLGFKIVFLSGRYLDKMAVTEANLKKAGFHTWEQLILKDPHLITPNALSYKSAMRENLLRQG 219          
BLAST of CX043905 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.067e-30
Identity = 75/182 (41.21%), Postives = 104/182 (57.14%), Query Frame = 1
Query:  205 SCLSWRLGVETNNVIGWATVPEKCAGYVGHYML-GQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTG-KAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSXETAVVYKSSERKKLEMKG 744
            +C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYAK G+G +  +P  +  W+ TG                   GI+ + L+ R +  +NVT  NL+ AG   W+ LILK +  S    VVYKS  RK L  KG
Sbjct:   51 NCRSWHLGVETSNIIDFDTVPANCKDYVEDYLITSKQYQYDSKTVCKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTEKTDPGAYWLWLGTGASTPGLPEALHLYQNIIELGIEPIILSDRWKLWKNVTLDNLEAAGVTYWKHLILKPNG-SNLRQVVYKSKVRKSLVKKG 231          
BLAST of CX043905 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 1.820e-30
Identity = 86/235 (36.60%), Postives = 120/235 (51.06%), Query Frame = 1
Query:   73 SMDIRHLFLATISATSHGFSMDIPHQIHLLRPKAGSRNN----DVPGLS-----CLSWRLGVETNNVIGWATVPEKCAGYVGHYML-GQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKA-XXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSXETAVVYKSSERKKLEMKG 744
            S+ +  L  AT+S      S  +P  I LL       N     +  GLS     C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYAK G+G +   P  +  W+ +G++                 GI+ + ++ R +    VT  NLK  G   W+ LILK +  S  T VVYKS  R  L  KG
Sbjct:    5 SLSLLLLLAATVSHVQS--SASVPGLIELLESNTIFGNEAELLEKEGLSINYPNCRSWHLGVETSNIINFDTVPANCKAYVEDYLITSKQYQYDSKTVNKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTENTAPGAYWSWLESGESTPGLPETLHLYENLLELGIEPIIISDRWKKLSEVTVENLKAVGVTKWKHLILKPNG-SKLTQVVYKSKVRNSLVKKG 236          
The following BLAST results are available for this feature:
BLAST of CX043905 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PPA1_SOLLC5.106e-4143.65Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1... [more]
VSPA_SOYBN3.310e-4046.20Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE... [more]
S25K_SOYBN3.310e-4046.20Stem 31 kDa glycoprotein (Fragment) OS=Glycine max... [more]
VSPB_SOYBN1.439e-3542.63Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE... [more]
VSP2_ARATH1.067e-3041.21Vegetative storage protein 2 OS=Arabidopsis thalia... [more]
VSP1_ARATH1.820e-3036.60Vegetative storage protein 1 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_14B09_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-14B09-D18-1-7.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043905 ID=CX043905; Name=CX043905; organism=Citrus sinensis; type=EST; length=746bp
AGCATGGGAGGGGTGTCACTGCCATTATTCTTCTTTTTTCTGGCTACCAT
ATCAGCAACATCCCATGGATTTAGCATGGACATCCGCCATCTTTTTCTGG
CTACCATATCAGCAACATCCCATGGATTTAGCATGGACATCCCCCATCAG
ATTCATCTTCTCCGACCGAAAGCCGGTTCCCGGAACAACGATGTTCCCGG
CTTGTCCTGCCTGAGTTGGCGACTCGGAGTGGAAACTAATAACGTTATAG
GATGGGCGACTGTTCCCGAAAAATGTGCAGGCTACGTGGGGCATTACATG
TTAGGCCAGCAGTACCGCATGGACTCTGAAGTGGTAGCTAATGAGGCCAT
TCTCTATGCGCAGAGCCTCAAGCTTGCTGGCGACGGCAAGAACATTTGGG
TTTTCGACATAGATGAAACCTCGCTATCTAATTTGCCATATTATGCTAAG
AATGGATTCGGGGTGAAGCCATACAACCCTACTTTGTTTAATGAATGGGT
GAACACCGGAAAAGCACCACCGCTGCCAGAGAGCCTTAAGCTTTACAAAA
AATTATTATTGCTTGGAATTAAGATTGTATTCCTCACGGGAAGACCAGAA
GATCAGAGAAATGTTACAGAAGCTAATTTAAAGCATGCTGGATTCGACAC
CTGGGAGAAGCTCATCCTCAAGGGATCATCTCACTCANGAGAAACAGCAG
TGGTGTACAAATCAAGTGAAAGAAAGAAGCTTGAGATGAAAGGGTA
back to top