GO241389

Overview
NameGO241389
Unique NameGO241389
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5655 contig Csv1_Contig5655:306..917. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: ATB13_ARATH (Homeobox-leucine zipper protein ATHB-13 OS=Arabidopsis thaliana GN=ATHB-13 PE=2 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 1.747e-60
Identity = 107/126 (84.92%), Postives = 116/126 (92.06%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKETEGSCS 379
            E+D+SDDGSQ GEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQ+AIWFQNRRARWKTKQLEKDYD LKRQ++ +KA+ + LQ  NQKL AEIM LK+RE TESINLNKETEGSCS
Sbjct:   72 EEDYSDDGSQMGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDTLKRQFDTLKAENDLLQTHNQKLQAEIMGLKNREQTESINLNKETEGSCS 197          

HSP 2 Score: 31.5722 bits (70), Expect = 1.747e-60
Identity = 23/79 (29.11%), Postives = 33/79 (41.77%), Query Frame = 3
Query:  393 SSDIKLDISRTPAIDSPMST--HP-----TSRNLFPTKSTSSVRPTVAAQLFHNSSSSGPDLQCQKIEQNMQGXKDQES 608
            S +++LDIS  P  +    T  HP       R+ FP    ++   T   Q F NSSS    ++ +    NM    D  S
Sbjct:  204 SDNLRLDISTAPPSNDSTLTGGHPPPPQTVGRHFFPPSPATATTTTTTMQFFQNSSSGQSMVKEENSISNMFCAMDDHS 282          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX21_ORYSJ (Homeobox-leucine zipper protein HOX21 OS=Oryza sativa subsp. japonica GN=HOX21 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 4.525e-55
Identity = 105/127 (82.68%), Postives = 114/127 (89.76%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSRE-VTESINLNKETEGSCS 379
            ED+ SDDGSQAGEKKRRLN+EQV+TLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYD LKRQ +AVKA+ +AL   N+KL AEI+ALK RE  +E INLNKETE SCS
Sbjct:  117 EDELSDDGSQAGEKKRRLNVEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKAENDALLNHNKKLQAEIVALKGREAASELINLNKETEASCS 243          

HSP 2 Score: 27.335 bits (59), Expect = 4.525e-55
Identity = 14/28 (50.00%), Postives = 20/28 (71.43%), Query Frame = 3
Query:  390 DSSDIKLDISRTPAID-SPMSTHPTSRN 470
            +SS+I LDISRTP  D + + T PT+ +
Sbjct:  248 NSSEINLDISRTPPPDAAALDTAPTAHH 275          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX21_ORYSI (Homeobox-leucine zipper protein HOX21 OS=Oryza sativa subsp. indica GN=HOX21 PE=2 SV=2)

HSP 1 Score: 207.223 bits (526), Expect = 1.704e-54
Identity = 105/127 (82.68%), Postives = 114/127 (89.76%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSRE-VTESINLNKETEGSCS 379
            ED+ SDDGSQAGEKKRRLN+EQV+TLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYD LKRQ +AVKA+ +AL   N+KL AEI+ALK RE  +E INLNKETE SCS
Sbjct:  111 EDELSDDGSQAGEKKRRLNVEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKAENDALLNHNKKLQAEIVALKGREAASELINLNKETEASCS 237          

HSP 2 Score: 25.409 bits (54), Expect = 1.704e-54
Identity = 13/28 (46.43%), Postives = 19/28 (67.86%), Query Frame = 3
Query:  390 DSSDIKLDISRTPAID-SPMSTHPTSRN 470
            +SS+I LDISRTP  D + +   PT+ +
Sbjct:  242 NSSEINLDISRTPPPDAAALDAAPTAHH 269          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: ATB23_ARATH (Homeobox-leucine zipper protein ATHB-23 OS=Arabidopsis thaliana GN=ATHB-23 PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 2.897e-51
Identity = 96/126 (76.19%), Postives = 115/126 (91.27%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKETEGSCS 379
            ++++SDDGS+ GEKKRRLNMEQ+K LEK+FELGNKLE +RK++LARALGLQPRQ+AIWFQNRRAR KTKQLEKDYD+LKRQ+E+++ + E LQ QNQKL A++MALKSRE  ESINLNKETEGSCS
Sbjct:   58 DEEYSDDGSKMGEKKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMALKSREPIESINLNKETEGSCS 183          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HAT7_ARATH (Homeobox-leucine zipper protein HAT7 OS=Arabidopsis thaliana GN=HAT7 PE=2 SV=4)

HSP 1 Score: 174.866 bits (442), Expect = 2.904e-43
Identity = 83/122 (68.03%), Postives = 104/122 (85.25%), Query Frame = 2
Query:    2 EDDFSDDGSQA--GEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKE 361
            ED+ SDDGS    GEKK+RLN+EQV+ LEK+FELGNKLEPERKMQLA+ALGLQPRQ+AIWFQNRRARWKTKQLE+DYD LK+Q++ +K+D ++L A N+KLHAE++ALK  +  ES  + +E
Sbjct:  100 EDNLSDDGSHMMLGEKKKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYDSLKKQFDVLKSDNDSLLAHNKKLHAELVALKKHDRKESAKIKRE 221          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: ATB20_ARATH (Homeobox-leucine zipper protein ATHB-20 OS=Arabidopsis thaliana GN=ATHB-20 PE=2 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 1.220e-41
Identity = 82/128 (64.06%), Postives = 106/128 (82.81%), Query Frame = 2
Query:    2 EDDFSDDGSQA--GEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKETEGSCS 379
            E++ SDDG+    GEKK+RL +EQVK LEK+FELGNKLEPERK+QLA+ALG+QPRQ+AIWFQNRRARWKT+QLE+DYD LK+Q+E++K+D  +L A N+KL AE+MALK++E  E   + +E E S S
Sbjct:   72 EENLSDDGAHTMLGEKKKRLQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFESLKSDNASLLAYNKKLLAEVMALKNKECNEGNIVKREAEASWS 199          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX23_ORYSJ (Homeobox-leucine zipper protein HOX23 OS=Oryza sativa subsp. japonica GN=HOX23 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.925e-40
Identity = 87/134 (64.93%), Postives = 101/134 (75.37%), Query Frame = 2
Query:   23 GSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALK--------------SREVTESINLN-KETEGSCS 379
            G   GEKKRRL++EQV+TLE++FE GNKLEPERK QLARALGLQPRQVAIWFQNRRARWKTKQLEKD+D L+RQ +A +A+ +AL + N KLHAEI+ALK                  +E INLN KETE SCS
Sbjct:   98 GGGGGEKKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDFDALRRQLDAARAENDALLSLNSKLHAEIVALKGGAAAAGGGGSSCRQEAASELINLNVKETEASCS 231          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX23_ORYSI (Homeobox-leucine zipper protein HOX23 OS=Oryza sativa subsp. indica GN=HOX23 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.925e-40
Identity = 87/134 (64.93%), Postives = 101/134 (75.37%), Query Frame = 2
Query:   23 GSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALK--------------SREVTESINLN-KETEGSCS 379
            G   GEKKRRL++EQV+TLE++FE GNKLEPERK QLARALGLQPRQVAIWFQNRRARWKTKQLEKD+D L+RQ +A +A+ +AL + N KLHAEI+ALK                  +E INLN KETE SCS
Sbjct:   98 GGGGGEKKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDFDALRRQLDAARAENDALLSLNSKLHAEIVALKGGAAAAGGGGSSCRQEAASELINLNVKETEASCS 231          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: ATHB5_ARATH (Homeobox-leucine zipper protein ATHB-5 OS=Arabidopsis thaliana GN=ATHB-5 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 9.364e-34
Identity = 71/123 (57.72%), Postives = 91/123 (73.98%), Query Frame = 2
Query:   26 SQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKETEGSCSIEVRQ 394
            S A EKKRRL +EQVK LEKNFE+ NKLEPERK++LA+ LGLQPRQVAIWFQNRRARWKTKQLE+DY +LK  ++A+K +R++LQ  N  L  +I  LK++   E +   +E     ++E  Q
Sbjct:   67 STAAEKKRRLGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALKRNRDSLQRDNDSLLGQIKELKAKLNVEGVKGIEENGALKAVEANQ 189          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX16_ORYSJ (Homeobox-leucine zipper protein HOX16 OS=Oryza sativa subsp. japonica GN=HOX16 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 6.710e-32
Identity = 72/130 (55.38%), Postives = 94/130 (72.31%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNK-ETEGSCSIEV 388
            E+++ D+  Q  EKKRRL  EQV  LE++FE  NKLEPERK +LAR LGLQPRQVA+WFQNRRARWKTKQLE+D+D LK  ++A++AD +AL   N +LH+++M+L     TE +   +  TEGS    V
Sbjct:   66 EEEYYDE--QLPEKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDALLQDNHRLHSQVMSL-----TEKLQEKETTTEGSAGAAV 188          
The following BLAST results are available for this feature:
BLAST of GO241389 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
ATB13_ARATH1.747e-6084.92Homeobox-leucine zipper protein ATHB-13 OS=Arabido... [more]
HOX21_ORYSJ4.525e-5582.68Homeobox-leucine zipper protein HOX21 OS=Oryza sat... [more]
HOX21_ORYSI1.704e-5482.68Homeobox-leucine zipper protein HOX21 OS=Oryza sat... [more]
ATB23_ARATH2.897e-5176.19Homeobox-leucine zipper protein ATHB-23 OS=Arabido... [more]
HAT7_ARATH2.904e-4368.03Homeobox-leucine zipper protein HAT7 OS=Arabidopsi... [more]
ATB20_ARATH1.220e-4164.06Homeobox-leucine zipper protein ATHB-20 OS=Arabido... [more]
HOX23_ORYSJ3.925e-4064.93Homeobox-leucine zipper protein HOX23 OS=Oryza sat... [more]
HOX23_ORYSI3.925e-4064.93Homeobox-leucine zipper protein HOX23 OS=Oryza sat... [more]
ATHB5_ARATH9.364e-3457.72Homeobox-leucine zipper protein ATHB-5 OS=Arabidop... [more]
HOX16_ORYSJ6.710e-3255.38Homeobox-leucine zipper protein HOX16 OS=Oryza sat... [more]

Pages

back to top
Libraries
Library NameType
Cara cara navel orange fruit cDNA librarycdna_library
Properties
Property NameValue
Genbank description37 Cara cara navel orange fruit cDNA library Citrus sinensis cDNA clone 119 5, mRNA sequence.