DT214591

Overview
NameDT214591
Unique NameDT214591
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length812
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214591_ssr61 microsatellite DT214591_ssr61:61..72. BLAST: Citrus ESTs to Prunus persica proteins V1
DT214591_ssr478 microsatellite DT214591_ssr478:478..489. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5500 contig Csv1_Contig5500:57..867. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214591 vs. ExPASy Swiss-Prot
Match: CAP10_ARATH (Putative clathrin assembly protein At5g35200 OS=Arabidopsis thaliana GN=At5g35200 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.585e-22
Identity = 68/153 (44.44%), Postives = 77/153 (50.33%), Query Frame = -3
Query:  370 GNGTAGWELALVIAPSSNENATAASKLAGGLDKLTLDSLYDDALR-RNSQNATYSTWGPQPMAGPTMQPNGHDPFYASGMVSAPHSVQMA-----AMXXXXXXXXXXXXXXXXXXXXXXXXXANPFANPYAANVHPYGSGMPVQAYNPYTGLM 810
            GN T GWELALV APSSNE A A SKLAGGLDKLTLDSLY+DA+R    QN +Y+ W   P+    M    H PFYAS  V+AP   QMA                                 NPF NP+ +N    G+    Q YNPY   M
Sbjct:  400 GNST-GWELALVTAPSSNEGAAADSKLAGGLDKLTLDSLYEDAIRVSQQQNRSYNPWEQNPVHNGHMM---HQPFYASNGVAAPQPFQMANQNHQTFGYQHQNAGMMMGPVQQPYQQQQQNMNNPFGNPFVSN----GNPQQPQGYNPYPRYM 544          
BLAST of DT214591 vs. ExPASy Swiss-Prot
Match: CAP8_ARATH (Putative clathrin assembly protein At2g01600 OS=Arabidopsis thaliana GN=At2g01600 PE=2 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.669e-11
Identity = 40/82 (48.78%), Postives = 45/82 (54.88%), Query Frame = -3
Query:  550 GWELALVIAPSSNENATAASKLAGGLDKLTLDSLYDDALRRNSQNATYSTWGPQPMAGPTMQPNGHDPFYASGMVSAPHSVQ 795
            GWELALV APSS+ +A+   KLAGGLD LTL SLYDD     SQ   Y    P P A        HDPF +S   + P   Q
Sbjct:  424 GWELALVTAPSSDISASTERKLAGGLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFA-------SHDPFASSNGTAPPPQQQ 498          
The following BLAST results are available for this feature:
BLAST of DT214591 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
CAP10_ARATH3.585e-2244.44Putative clathrin assembly protein At5g35200 OS=Ar... [more]
CAP8_ARATH1.669e-1148.78Putative clathrin assembly protein At2g01600 OS=Ar... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_04F02_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0004d_C01_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214591 ID=DT214591|Name=DT214591|organism=Citrus sinensis|type=EST|length=812bp
AGATTACAGCTCTTTTATATCATCTACAAGAAAATCTTACCAGAGGCTGT
CCAAGGAAAAAATAATAATAATAAACAAGAATAAGATTCCTGCCCGAGCA
TCAACAACTTCAAACAGGTAAAAAAAAAAAAGGTAGTTTAGAAAACTATT
ATTATCCACTTGTCAAGATAAATAATCAACAATCAAGAAACCTCCCTCTC
ACTAATTATTTAAGAAAGAATCTCATTCTAGCTAACACTGCACAACATAT
GGTACACGACGATCTATTCTTGAAACATTCCCGCATTTCGAAATCCTCAA
CCAACTATTCCCCACTTTTTCACCTCCATGTTTACTGATGTCGAAAATAT
CCTTTGTGCAAATCATCTACATAAGACCTGTATACGGGTTGTAGGCTTGA
ACAGGCATACCTGAACCATAAGGGTGGACATTGGCTGCATATGGGTTTGC
AAAAGGATTTGCAGTCTGTTGTGGGGCCATCATCATCATCTGCTGCTGTT
GTTGCTGCTGCAACATAAAAGCATGCTGCTGATTTGCCATGGCTGCCATC
TGCACTGAATGTGGAGCAGAAACCATGCCTGAGGCATAAAAGGGATCATG
TCCATTTGGTTGCATCGTTGGACCAGCCATTGGTTGTGGCCCCCAAGTAC
TGTAGGTCGCATTCTGGCTGTTTCTTCTTAATGCATCATCGTACAGGCTG
TCCAATGTAAGCTTGTCCAGCCCTCCCGCCAATTTGCTGGCAGCAGTGGC
ATTTTCATTTGAGCTTGGAGCAATAACAAGTGCCAATTCCCAGCCTGCAG
TTCCATTTCCTT
back to top