DT214535

Overview
NameDT214535
Unique NameDT214535
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length369
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5318 contig Csv1_Contig5318:336..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: XCP2_ARATH (Xylem cysteine proteinase 2 OS=Arabidopsis thaliana GN=XCP2 PE=1 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 1.639e-34
Identity = 69/99 (69.70%), Postives = 78/99 (78.79%), Query Frame = -1
Query:   73 LKALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIKFK 369
            LKALA+QP+SV I+AS ++FQ YSGG+FDG CG   +H V AVGYGSS      DYIIVKNSWGPKWGE GYIR+KRNTG P GLC INK+ASFP K K
Sbjct:  261 LKALAHQPLSVAIDASGREFQFYSGGVFDGRCGVDLDHGVAAVGYGSSKGS---DYIIVKNSWGPKWGEKGYIRLKRNTGKPEGLCGINKMASFPTKTK 356          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.388e-33
Identity = 66/99 (66.67%), Postives = 78/99 (78.79%), Query Frame = -1
Query:   73 LKALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIKFK 369
            +KALA+QPVSV IEAS +DFQ Y GG+F+G CGT  +H V AVGYGSS      DY+IVKNSWGP+WGE G+IR+KRNTG P GLC INK+AS+P K K
Sbjct:  260 VKALAHQPVSVAIEASGRDFQFYKGGVFNGKCGTDLDHGVAAVGYGSSKGS---DYVIVKNSWGPRWGEKGFIRMKRNTGKPEGLCGINKMASYPTKTK 355          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: PAPA4_CARPA (Papaya proteinase 4 OS=Carica papaya PE=1 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 1.941e-27
Identity = 55/97 (56.70%), Postives = 73/97 (75.26%), Query Frame = -1
Query:   79 LKALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIK 369
            L A+A+QPVSV +E++ +DFQ+Y GGIF+GSCGT  +HAVTAVGYG S       YI++KNSWGP WGE GYIRI+R +G   G+C + + + +PIK
Sbjct:  254 LNAIAHQPVSVVVESAGRDFQNYKGGIFEGSCGTKVDHAVTAVGYGKSGGK---GYILIKNSWGPGWGENGYIRIRRASGNSPGVCGVYRSSYYPIK 347          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: PAPA2_CARPA (Chymopapain OS=Carica papaya PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 3.660e-26
Identity = 55/97 (56.70%), Postives = 69/97 (71.13%), Query Frame = -1
Query:   79 LKALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIK 369
            L ALANQP+SV +EA  K FQ Y  G+FDG CGT  +HAVTAVGYG+S   +  +YII+KNSWGP WGE GY+R+KR +G   G C + K + +P K
Sbjct:  256 LGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTS---DGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFK 349          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: CYSEP_VIGMU (Vignain OS=Vigna mungo PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.153e-26
Identity = 55/97 (56.70%), Postives = 68/97 (70.10%), Query Frame = -1
Query:   79 LKALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIK 369
            LKA+ANQPVSV I+A   DFQ YS G+F G C T  NH V  VGYG++   +  +Y IV+NSWGP+WGE GYIR++RN     GLC I  +AS+PIK
Sbjct:  251 LKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCNTDLNHGVAIVGYGTTV--DGTNYWIVRNSWGPEWGEQGYIRMQRNISKKEGLCGIAMMASYPIK 345          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 1.391e-25
Identity = 57/98 (58.16%), Postives = 69/98 (70.41%), Query Frame = -1
Query:   76 KALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRN-TGLPGGLCAINKLASFPIKF 366
            KA++ QPVSV IEA  + FQHY  GIF GSCGT  +HAV AVGYGS +    VDY IV+NSWGP+WGE GYIR++RN      G C I   AS+P+K+
Sbjct:  269 KAISYQPVSVAIEAGGRIFQHYQSGIFTGSCGTNLDHAVVAVGYGSEN---GVDYWIVRNSWGPRWGEEGYIRMERNLAASKSGKCGIAVEASYPVKY 363          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: CYSEP_PHAVU (Vignain OS=Phaseolus vulgaris PE=2 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 1.816e-25
Identity = 55/97 (56.70%), Postives = 67/97 (69.07%), Query Frame = -1
Query:   79 LKALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIK 369
            LKA+ANQPVSV I+A   DFQ YS G+F G C T  NH V  VGYG  ++ +  +Y IV+NSWGP+WGE GYIR++RN     GLC I  L S+PIK
Sbjct:  251 LKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCSTDLNHGVAIVGYG--TTVDGTNYWIVRNSWGPEWGEHGYIRMQRNISKKEGLCGIAMLPSYPIK 345          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: CYSP2_HORVU (Cysteine proteinase EP-B 2 OS=Hordeum vulgare GN=EPB2 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.098e-25
Identity = 53/96 (55.21%), Postives = 67/96 (69.79%), Query Frame = -1
Query:   79 KALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIK 366
            +A+ANQPVSV +EAS K F  YS G+F G CGT  +H V  VGYG +   +A  Y  VKNSWGP WGE GYIR+++++G  GGLC I   AS+P+K
Sbjct:  261 RAVANQPVSVAVEASGKAFMFYSEGVFTGECGTELDHGVAVVGYGVAEDGKA--YWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVK 354          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: CYSP1_HORVU (Cysteine proteinase EP-B 1 OS=Hordeum vulgare GN=EPB1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.098e-25
Identity = 53/96 (55.21%), Postives = 67/96 (69.79%), Query Frame = -1
Query:   79 KALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIK 366
            +A+ANQPVSV +EAS K F  YS G+F G CGT  +H V  VGYG +   +A  Y  VKNSWGP WGE GYIR+++++G  GGLC I   AS+P+K
Sbjct:  261 RAVANQPVSVAVEASGKAFMFYSEGVFTGDCGTELDHGVAVVGYGVAEDGKA--YWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVK 354          
BLAST of DT214535 vs. ExPASy Swiss-Prot
Match: ORYB_ORYSJ (Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 4.047e-25
Identity = 52/96 (54.17%), Postives = 67/96 (69.79%), Query Frame = -1
Query:   79 KALANQPVSVGIEASSKDFQHYSGGIFDGSCGTYPNHAVTAVGYGSSSSPEAVDYIIVKNSWGPKWGEGGYIRIKRNTGLPGGLCAINKLASFPIK 366
            KA+A+QPVSV IEA  ++FQ Y  G+F G CGT  +H V AVGYG+ +     DY IV+NSWGPKWGE GY+R++RN  +  G C I  +AS+P K
Sbjct:  266 KAVAHQPVSVAIEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGK---DYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYPTK 358          
The following BLAST results are available for this feature:
BLAST of DT214535 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 87
Match NameE-valueIdentityDescription
XCP2_ARATH1.639e-3469.70Xylem cysteine proteinase 2 OS=Arabidopsis thalian... [more]
XCP1_ARATH1.388e-3366.67Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
PAPA4_CARPA1.941e-2756.70Papaya proteinase 4 OS=Carica papaya PE=1 SV=3[more]
PAPA2_CARPA3.660e-2656.70Chymopapain OS=Carica papaya PE=1 SV=2[more]
CYSEP_VIGMU8.153e-2656.70Vignain OS=Vigna mungo PE=1 SV=1[more]
GCP1_ARATH1.391e-2558.16Germination-specific cysteine protease 1 OS=Arabid... [more]
CYSEP_PHAVU1.816e-2556.70Vignain OS=Phaseolus vulgaris PE=2 SV=2[more]
CYSP2_HORVU3.098e-2555.21Cysteine proteinase EP-B 2 OS=Hordeum vulgare GN=E... [more]
CYSP1_HORVU3.098e-2555.21Cysteine proteinase EP-B 1 OS=Hordeum vulgare GN=E... [more]
ORYB_ORYSJ4.047e-2554.17Oryzain beta chain OS=Oryza sativa subsp. japonica... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Seed cDNA Library UCRCS09-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS09_13B10_b2 Ruby Orange Developing Seed cDNA Library UCRCS09-2 Citrus sinensis cDNA clone UCRCS09-13B10-C20-1-6.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214535 ID=DT214535|Name=DT214535|organism=Citrus sinensis|type=EST|length=369bp
CATTCATTGAANGCACAAGATATTATTTTTAGTCATAACTGAAGGCAAAC
ATACTATACACAGTTAAGTGGTCTTGAACTTGATGGGGAATGAAGCCAAC
TTGTTGATAGCACATAGGCCACCAGGTAATCCGGTGTTTCTCTTAATCCT
GATGTAGCCTCCCTCTCCCCATTTGGGTCCCCATGAATTTTTGACAATTA
TGTAATCCACTGCCTCCGGTGAAGAAGAAGATCCATACCCAACTGCTGTC
ACTGCGTGATTGGGATATGTTCCACAGGAGCCGTCGAATATACCCCCGCT
GTAATGTTGGAAATCCTTGCTAGAAGCCTCAATGCCGACGCTAACGGGCT
GGTTCGCCAGTGCTTTCAA
back to top