DT214495

Overview
NameDT214495
Unique NameDT214495
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length715
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7844 contig Csv1_Contig7844:651..1364. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214495 vs. ExPASy Swiss-Prot
Match: SF21_HELAN (Pollen-specific protein SF21 OS=Helianthus annuus GN=SF21 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.428e-40
Identity = 80/126 (63.49%), Postives = 98/126 (77.78%), Query Frame = -1
Query:  302 NVWHFLEANNGRPDISEGLRKLQCRSLIFVGESSPFHSEAVHMTSKIDRRYSALVEVQACGSMVTEEQPHAMLIPMEYFLMGYGLYRP-TLSVSPRSPLSPCCISPELLSPESMGLKLKPIKTRIS 676
            NVW +L+A + R DI+E L+ L+C+++IFVG+SSPFH EA+ +  K+    SALVEV ACGSMVT+EQPHAMLIP+E FL G+GLYRP   S SPRSPL P  I PELL PE MGLKL+PIK R+S
Sbjct:  219 NVWRYLQAIDSRRDITEELKSLECKTIIFVGDSSPFHDEALQIAEKLGTNCSALVEVHACGSMVTQEQPHAMLIPLENFLKGFGLYRPCRYSNSPRSPLGPSSIDPELLYPEKMGLKLRPIKLRVS 344          

HSP 2 Score: 21.557 bits (44), Expect = 1.428e-40
Identity = 8/11 (72.73%), Postives = 10/11 (90.91%), Query Frame = -3
Query:  681 ACRRLLEERQS 713
            ACR+LL+ER S
Sbjct:  207 ACRKLLDERDS 217          
The following BLAST results are available for this feature:
BLAST of DT214495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SF21_HELAN1.428e-4063.49Pollen-specific protein SF21 OS=Helianthus annuus ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_18G04_b2 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-2 Citrus sinensis cDNA clone UCRCS07-18G04-N8-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214495 ID=DT214495|Name=DT214495|organism=Citrus sinensis|type=EST|length=715bp
TGCTTTGCAGCCTTTCTATTATCATTATTTGCTTGTCATTGGTAAATAAT
TCCTTTAGAGGATTTACAGATTACTGACCCACTCCTCAACTAACATTTAT
GGATACATATAAAAGAATTATACCTGATTTCTGTTTAATATATAACCTAG
TATCTTTCCTGCTCTTTCCCTATTTACAATGCTCTGTAAATTTACTCTTC
TGTCGTCTCGACCAATCAGAAAACTTTACATGCACCTTAACCATATTATT
GCAAAAAAGAACCACGCCTTCCTCTTCCATCTTATATTAGATGATTCCCG
CAGAAATTCGAGTTTTTATTGGTTTTAACTTCAAGCCCATGCTTTCGGGT
GAAAGAAGCTCTGGGGAGATGCAACACGGACTCAATGGACTTCTTGGGCT
AACACTTAGAGTTGGTCTGTACAATCCATATCCCATGAGAAAGTACTCCA
TTGGTATCAACATGGCATGGGGCTGCTCCTCTGTCACCATCGATCCACAT
GCCTGAACCTCAACCAAAGCACTATATCTTCTATCAATTTTAGAAGTCAT
GTGGACAGCCTCAGAATGGAAAGGAGAGCTTTCACCAACAAATATTAGAG
AGCGGCATTGCAGTTTCCGCAGCCCTTCGCTGATGTCGGGTCTCCCATTA
TTTGCTTCAAGAAAATGCCAAACATTTTGAGCTCTGTCTTTCCTCCAGCA
GTCTTCTGCATGCCT
back to top